ABCB7 Recombinant Protein Antigen

Name: ABCB7 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89313PEP
Price: 279 USD

Images

There are currently no images for ABCB7 Protein (NBP1-89313PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

ABCB7 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCB7. Source: E. coli Amino Acid Sequence: GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ABCB7
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCB7 Recombinant Protein Antigen

ABC transporter 7 protein
ABC7ATP-binding cassette sub-family B member 7, mitochondrial
ASATATP-binding cassette 7
Atm1p
ATP-binding cassette transporter 7
ATP-binding cassette, sub-family B (MDR/TAP), member 7
EC 3.6.3
EC 3.6.3.42
EST140535

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC)transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes aredivided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of theMDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigenpresentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to thecytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis.Mutations in this gene have been implicated in X-linked sideroblastic anemia with ataxia. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Choline kinase
alpha Antibody

NBP1-85630

Immunohistochemistry-Paraffin Choline kinase alpha Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Choline Kinase
beta [Unconjugated]

8184-CK

Species: Hu

Applications: EnzAct

GGT1 Antibody (1F9)

H00002678-M01

Immunohistochemistry-Paraffin GGT1 Antibody (1F9)

(10 Publications)

Species: Hu, Mu, Ye

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

SLPI [HRP]

DPI00

(37 Publications)

Species: Hu

Applications: ELISA

FoxC2 Antibody

AF6989

(27 Publications)

Species: Mu

Applications: IHC

FMN1 Antibody (4F4)

H00342184-M07

Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)

Species: Hu

Applications: ELISA, ICC/IF, WB

CCL27/CTACK [HRP]

DCC270

(10 Publications)

Species: Hu

Applications: ELISA

ASRGL1 Antibody

NBP1-89133

Immunohistochemistry-Paraffin ASRGL1 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Alkaline
Phosphatase/ALPP Anti ...

NB110-3638

Immunohistochemistry-Paraffin Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free

Western Blot Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free

(1 Review)

(16 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB

ATRNL1 Antibody -
Azide and BSA Free

NBP2-92749

Species: Hu, Mu

Applications: WB

NAT10 Antibody
(5Z3E5)

NBP3-15742

Immunohistochemistry NAT10 Antibody (5Z3E5)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

PDLIM3 Antibody
(HL2075) - Azide and ...

NBP3-25358

Western Blot PDLIM3 Antibody (HL2075) - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

ABCB6 Antibody

NBP3-41339

Immunohistochemistry-Paraffin ABCB6 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

Glucose 6
phosphate isomerase A ...

NBP2-02541

Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)

(1 Publication)

Species: Hu, Pm, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

FABP6 Antibody
[Unconjugated]

AF3880

(2 Publications)

Species: Hu

Applications: ICC, WB

Integrin beta
3/CD61 Antibody (SJ19

NBP2-67416

Immunohistochemistry-Paraffin Integrin beta 3/CD61 Antibody (SJ19-09)

(2 Reviews)

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Integrin alpha
2b/CD41 Antibody (745 ...

MAB7616

Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]

(6 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, WB

Publications for ABCB7 Protein (NBP1-89313PEP) (0)

There are no publications for ABCB7 Protein (NBP1-89313PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB7 Protein (NBP1-89313PEP) (0)

There are no reviews for ABCB7 Protein (NBP1-89313PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCB7 Protein (NBP1-89313PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCB7 Products

Research Areas for ABCB7 Protein (NBP1-89313PEP)

Find related products by research area.

Blogs on ABCB7

There are no specific blogs for ABCB7, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Immunocytochemistry/Immunofluorescence: Alkaline Phosphatase/ALPP Antibody (8B6) [NB110-3638] - Representative montage images are shown for control dissociated DRG culture. (B) Dissociated DRGs cultures exposed to conditioned medium from alkaline phosphatase-expressing rat GRPs. Image collected and cropped by CiteAb from the following publication (eneuro.org/content/4/1/ENEURO.0171-16.2017), licensed under a CC-BY license.

Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
NB110-3638

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our ABCB7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ABCB7

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ABCB7 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

ABCB7 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ABCB7 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ABCB7 Protein (NBP1-89313PEP) (0)

Reviews for ABCB7 Protein (NBP1-89313PEP) (0)

FAQs for ABCB7 Protein (NBP1-89313PEP) (0)

Additional ABCB7 Products

Research Areas for ABCB7 Protein (NBP1-89313PEP)

Blogs on ABCB7

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics