Home » Yes » Yes Proteins » Yes Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Yes Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Yes Protein (NBP1-85369PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Yes Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YES1.

Source: E. coli

Amino Acid Sequence: KSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
YES1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85369.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Yes Recombinant Protein Antigen

  • cellular yes-1 protein
  • c-yes
  • EC 2.7.10
  • EC 2.7.10.2
  • HsT441
  • P61-YES
  • Proto-oncogene c-Yes
  • proto-oncogene tyrosine-protein kinase Yes
  • v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
  • Yamaguchi sarcoma oncogene
  • Yes
  • YES1

Background

Yes1 is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Fyn Antibody
(FYN-01) - BSA Free
NB500-517
Immunoprecipitation Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
Immunocytochemistry/ Immunofluorescence Fyn Antibody (FYN-01) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
FAK Antibody
[Unconjugated]
AF4467
Immunohistochemistry FAK Antibody [Unconjugated]
Knockout Validated FAK Antibody [Unconjugated]
Western Blot FAK Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Lyn Antibody
[Unconjugated]
AF3206
Western Blot Lyn Antibody [Unconjugated]
Simple Western Lyn Antibody [Unconjugated]
Immunocytochemistry Lyn Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Fgr Antibody
NBP1-85677
Immunohistochemistry-Paraffin Fgr Antibody
Immunohistochemistry-Paraffin Fgr Antibody
Immunohistochemistry-Paraffin Fgr Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Lck [p Tyr394]
Antibody (755103)
MAB7500
Immunocytochemistry Lck [p Tyr394] Antibody (755103)
Western Blot Lck [p Tyr394] Antibody (755103)
(11 Publications)
Species: Hu
Applications: ICC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
c-Abl Antibody
[Unconjugated]
AF5414
Western Blot c-Abl Antibody [Unconjugated]
Simple Western c-Abl Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Hck Antibody
(394903)
MAB3915
Western Blot Hck Antibody (394903)
(1 Publication)
Species: Hu, Mu
Applications: WB
CSK Antibody
NBP1-85951
Immunocytochemistry/ Immunofluorescence CSK Antibody
Western Blot CSK Antibody
Western Blot CSK Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Yes Recombinant
Protein Antigen
NBP1-85369PEP
Yes Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Yes Protein (NBP1-85369PEP) (0)

There are no publications for Yes Protein (NBP1-85369PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Yes Protein (NBP1-85369PEP) (0)

There are no reviews for Yes Protein (NBP1-85369PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Yes Protein (NBP1-85369PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Yes Products

Array NBP1-85369PEP

Research Areas for Yes Protein (NBP1-85369PEP)

Find related products by research area.

Blogs on Yes

There are no specific blogs for Yes, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Yes Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol YES1