Home » WNK1 » WNK1 Proteins » WNK1 Recombinant Protein Antigen

WNK1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for WNK1 Protein (NBP2-32434PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

WNK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WNK1.

Source: E. coli

Amino Acid Sequence: PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WNK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32434.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WNK1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • Erythrocyte 65 kDa protein
  • HSAN2hereditary sensory neuropathy, type II
  • HSN2MGC163339
  • hWNK1
  • KDP
  • KDPMGC163341
  • KIAA0344
  • Kinase deficient protein
  • p65
  • PHA2C
  • PRKWNK1
  • PRKWNK1PSK
  • prostate-derived sterile 20-like kinase
  • Protein kinase lysine-deficient 1
  • Protein kinase with no lysine 1
  • protein kinase, lysine deficient 1
  • serine/threonine-protein kinase WNK1
  • WNK lysine deficient protein kinase 1
  • WNK1

Background

WNK lysine deficient protein kinase 1 (WNK1) is a cytoplasmic serine-threonine kinase expressed in the distal nephron which likely plays an important role in hypertension. WNK1 is responsible for controling Na+ and Cl- ion transport by inhibiting the activity of other related protein kinases, such as WNK4.

WNK1 mutations have been associated with Gordon hyperkalemia-hypertension syndrome (pseudohypoaldosteronism type II) and congenital sensory neuropathy.

WNK1 is also known as Human Accelerated Region 5, and is thought to have played a key role in differentiating humans from apes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
CD40/TNFRSF5
Antibody (mAb89) - Az ...
DDX0131P-100
Immunocytochemistry/ Immunofluorescence CD40/TNFRSF5 Antibody (mAb89) - Azide and BSA Free
Immunohistochemistry CD40/TNFRSF5 Antibody (mAb89) - Azide and BSA Free
(13 Publications)
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
ARHGEF7 Antibody -
BSA Free
NBP1-88650
Western Blot ARHGEF7 Antibody - BSA Free
Immunohistochemistry-Paraffin ARHGEF7 Antibody - BSA Free
Immunohistochemistry-Paraffin ARHGEF7 Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P, KD, WB
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Flow Cytometry ASCC1 Antibody (OTI6G5)
Flow Cytometry ASCC1 Antibody (OTI6G5)
Western Blot ASCC1 Antibody (OTI6G5)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
IkB-alpha Antibody
(6A920) - BSA Free
NB100-56507
Western Blot IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free
(42 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(141 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
c-Rel Antibody
[Unconjugated]
AF2699
Simple Western c-Rel Antibody [Unconjugated]
Western Blot c-Rel Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Mu
Applications: Simple Western, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(24 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/ Immunofluorescence ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Neurofascin
Antibody
AF3235
Western Blot Neurofascin Antibody
Immunohistochemistry Neurofascin Antibody
Immunohistochemistry Neurofascin Antibody
(1 Review)
(33 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]
Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]
Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]
(1 Review)
(184 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB

Publications for WNK1 Protein (NBP2-32434PEP) (0)

There are no publications for WNK1 Protein (NBP2-32434PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WNK1 Protein (NBP2-32434PEP) (0)

There are no reviews for WNK1 Protein (NBP2-32434PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WNK1 Protein (NBP2-32434PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WNK1 Products

Array NBP2-32434PEP

Research Areas for WNK1 Protein (NBP2-32434PEP)

Find related products by research area.

Blogs on WNK1

There are no specific blogs for WNK1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WNK1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol WNK1