![Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-VPS37B antibody NBP1-82283 (A) shows similar protein distribution across tissues to independent antibody NBP2-38398 (B).](http://images.novusbio.com/fullsize/VPS37B-Antibody-Immunohistochemistry-Paraffin-NBP1-82283-img0008.jpg "Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-VPS37B antibody NBP1-82283 (A) shows similar protein distribution across tissues to independent antibody NBP2-38398 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VPS37B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for VPS37B Antibody (NBP1-82283)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | VPS37B |
![Western Blot: VPS37B Antibody [NBP1-82283] - Analysis using Anti-VPS37B antibody NBP1-82283 (A) shows similar pattern to independent antibody NBP2-38398 (B).](http://images.novusbio.com/fullsize/VPS37B-Antibody-Western-Blot-NBP1-82283-img0009.jpg "Western Blot: VPS37B Antibody [NBP1-82283] - Analysis using Anti-VPS37B antibody NBP1-82283 (A) shows similar pattern to independent antibody NBP2-38398 (B).")
![Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/VPS37B-Antibody-Immunohistochemistry-Paraffin-NBP1-82283-img0014.jpg "Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: VPS37B Antibody [NBP1-82283] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/VPS37B-Antibody-Western-Blot-NBP1-82283-img0007.jpg "Western Blot: VPS37B Antibody [NBP1-82283] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/VPS37B-Antibody-Immunohistochemistry-Paraffin-NBP1-82283-img0005.jpg "Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human fallopian tube shows strong positivity in apical membrane and moderate cytoplasmic staining in glandular cells.](http://images.novusbio.com/fullsize/VPS37B-Antibody-Immunohistochemistry-Paraffin-NBP1-82283-img0010.jpg "Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human fallopian tube shows strong positivity in apical membrane and moderate cytoplasmic staining in glandular cells.")
![Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/VPS37B-Antibody-Immunohistochemistry-Paraffin-NBP1-82283-img0011.jpg "Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human lymph node.](http://images.novusbio.com/fullsize/VPS37B-Antibody-Immunohistochemistry-Paraffin-NBP1-82283-img0012.jpg "Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/VPS37B-Antibody-Immunohistochemistry-Paraffin-NBP1-82283-img0013.jpg "Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human cerebral cortex.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")