Novus Biologicals products are now on bio-techne.com

USP11 Recombinant Protein Antigen

Name: USP11 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-80640PEP
Price: 279 USD

Images

There are currently no images for USP11 Protein (NBP1-80640PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

USP11 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP11. Source: E. coli Amino Acid Sequence: ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	USP11
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USP11 Recombinant Protein Antigen

Deubiquitinating enzyme 11
EC 3.1.2.15
EC 3.4.19.12
ubiquitin carboxyl-terminal hydrolase 11
ubiquitin specific peptidase 11
ubiquitin specific protease 11
Ubiquitin Thioesterase 11
Ubiquitin thiolesterase 11
ubiquitin-specific processing protease 11
Ubiquitin-specific-processing protease 11
UHX1
UHX1ubiquitin carboxyl-terminal hydrolase, X-linked
USP11

Background

Protein ubiquitination controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. This dynamic process, involving ubiquitin conjugating enzymes and deubiquitinating enzymes, adds and removes ubiquitin. Deubiquitinating enzymes are cysteine proteases that specifically cleave ubiquitin from ubiquitin-conjugated protein substrates. This gene encodes a deubiquitinating enzyme which lies in a gene cluster on chromosome Xp11.23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCTAIRE1 Antibody

NBP1-92248

(4 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

UCH-L3 Antibody

NBP1-86037

Immunohistochemistry-Paraffin UCH-L3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

RP2 Antibody

NBP1-56852

Immunohistochemistry-Paraffin RP2 Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, WB

IL-6 [HRP]

M6000B

(661 Publications)

Species: Mu

Applications: ELISA

USP4 Antibody

NBP2-20834

Species: Hu, Mu

Applications: IHC, IHC-P, WB

UCH-L1/PGP9.5
Antibody (31A3)

NB600-1160

Immunocytochemistry/ Immunofluorescence UCH-L1/PGP9.5 Antibody (31A3)

Western Blot UCH-L1/PGP9.5 Antibody (31A3)

(1 Review)

(15 Publications)

Species: Bv, Ca, Hu, Mu, Po, Rt, Ze

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

RANBP9 Antibody
(4P10V6)

NBP3-15702

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

53BP1 Antibody -
BSA Free

NB100-304

Knockout Validated 53BP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence 53BP1 Antibody - BSA Free

(14 Reviews)

(754 Publications)

Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt

Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB

PARP Antibody
(194C1439) - Cleaved ...

NBP2-27335

Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt(-)

Applications: CyTOF-ready, Flow, ICC/IF, WB

BRCA2 Antibody
(234403) [Unconjugate

MAB2476

Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]

(13 Publications)

Species: Hu

Applications: IHC, WB

IkB-alpha Antibody
(6A920) - BSA Free

NB100-56507

Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free

(42 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB

USP15 Antibody
(1C10)

H00009958-M01

(16 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IP, WB

Regucalcin Antibody

NBP1-80849

Immunohistochemistry-Paraffin Regucalcin Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Pancreatic Amylase
Alpha Antibody (OTI6D ...

NBP1-47659

(1 Review)

Species: Hu

Applications: IHC, IHC-P, WB

TGF-beta RI/ALK-5
Antibody [Unconjugate ...

AF3025

Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]

(16 Publications)

Species: Hu

Applications: ELISA, ICC, WB

PHF16 Antibody

NBP2-55990

Immunocytochemistry/ Immunofluorescence PHF16 Antibody

Species: Hu

Applications: ICC/IF, WB

POLG2 Antibody -
BSA Free

NBP2-94064

Immunohistochemistry-Paraffin POLG2 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

USP11 Recombinant
Protein Antigen

NBP1-80640PEP

Species: Hu

Applications: AC

Publications for USP11 Protein (NBP1-80640PEP) (0)

There are no publications for USP11 Protein (NBP1-80640PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP11 Protein (NBP1-80640PEP) (0)

There are no reviews for USP11 Protein (NBP1-80640PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for USP11 Protein (NBP1-80640PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP11 Products

Research Areas for USP11 Protein (NBP1-80640PEP)

Find related products by research area.

Blogs on USP11

There are no specific blogs for USP11, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Total protein from HeLa, A431, Neuro2A, and PC12 was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL in 5% block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence. The observed molecular weight for these samples are ~250 kDa and the theoretical molecular weight is 214 kDa.

53BP1 Antibody - BSA Free
NB100-304

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our USP11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

USP11

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

USP11 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

USP11 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for USP11 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for USP11 Protein (NBP1-80640PEP) (0)

Reviews for USP11 Protein (NBP1-80640PEP) (0)

FAQs for USP11 Protein (NBP1-80640PEP) (0)

Additional USP11 Products

Research Areas for USP11 Protein (NBP1-80640PEP)

Blogs on USP11

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics