![Western Blot: Use1/UBE2Z Antibody [NBP1-82785] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Western-Blot-NBP1-82785-img0007.jpg "Western Blot: Use1/UBE2Z Antibody [NBP1-82785] - Analysis in human cell line RPMI-8226.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USE1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Use1/UBE2Z Antibody (NBP1-82785)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USE1 |
![Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Immunohistochemistry-Paraffin-NBP1-82785-img0010.jpg "Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.")
![Western Blot: Use1/UBE2Z Antibody [NBP1-82785] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Western-Blot-NBP1-82785-img0005.jpg "Western Blot: Use1/UBE2Z Antibody [NBP1-82785] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
![Western Blot: Use1/UBE2Z Antibody [NBP1-82785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Western-Blot-NBP1-82785-img0006.jpg "Western Blot: Use1/UBE2Z Antibody [NBP1-82785] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Immunohistochemistry-Paraffin-NBP1-82785-img0002.jpg "Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Immunohistochemistry-Paraffin-NBP1-82785-img0008.jpg "Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human lymphoid node shows moderate cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Immunohistochemistry-Paraffin-NBP1-82785-img0009.jpg "Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human lymphoid node shows moderate cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Use1-UBE2Z-Antibody-Immunohistochemistry-Paraffin-NBP1-82785-img0011.jpg "Immunohistochemistry-Paraffin: Use1/UBE2Z Antibody [NBP1-82785] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry Mxi1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mxi1_AF4185_Immunocytochemistry__Immunofluorescence_20286.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")