Home » Urotensin-2 » Urotensin-2 Proteins » Urotensin-2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Urotensin-2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Urotensin-2 Protein (NBP1-87223PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Urotensin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UTS2.

Source: E. coli

Amino Acid Sequence: TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UTS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87223.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Urotensin-2 Recombinant Protein Antigen

  • UCN2
  • UII
  • UIIPRO1068
  • U-IIUrotensin II
  • urotensin 2
  • urotensin-2
  • UrotensinII
  • Urotensin-II
  • UTS2

Background

Urotensin-2 encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

UTS2D Antibody
NBP1-80652
Immunohistochemistry-Paraffin UTS2D Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Corticotropin
Releasing Factor Anti ...
H00001392-M02
Western Blot Corticotropin Releasing Factor Antibody (2B11)
Sandwich ELISA Corticotropin Releasing Factor Antibody (2B11)
(4 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Urocortin Antibody
(749606)
MAB7447
Western Blot Urocortin Antibody (749606)
Immunohistochemistry Urocortin Antibody (749606)
(2 Publications)
Species: Hu
Applications: IHC, WB
Endothelin-1 [HRP]
QET00B
N/A Endothelin-1 [HRP]
N/A Endothelin-1 [HRP]
(48 Publications)
Species: Hu
Applications: ELISA
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ZRSR2 Antibody
NBP1-57317
Immunohistochemistry-Paraffin ZRSR2 Antibody
Western Blot ZRSR2 Antibody
Immunohistochemistry ZRSR2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
UNC50 Antibody -
Azide and BSA Free
NBP2-93822
Western Blot UNC50 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: WB
C1QL1
[Unconjugated]
9134-TN
Bioactivity C1QL1 [Unconjugated]
Species: Hu
Applications: BA
Urocortin 3
Antibody
NB100-93444
Western Blot Urocortin 3 Antibody
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
CRHR2/CRF2 Antibody
NB100-56485
Simple Western CRHR2/CRF2 Antibody
Western Blot CRHR2/CRF2 Antibody
(1 Review)
(4 Publications)
Species: Bv, Ca, Ch, Hu, Ma, Mu, Rt
Applications: ICC/IF, Simple Western, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CRHR1/CRF1 Antibody
NBP1-00175
Immunocytochemistry/ Immunofluorescence CRHR1/CRF1 Antibody
Immunocytochemistry/ Immunofluorescence CRHR1/CRF1 Antibody
Western Blot CRHR1/CRF1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB

Publications for Urotensin-2 Protein (NBP1-87223PEP) (0)

There are no publications for Urotensin-2 Protein (NBP1-87223PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Urotensin-2 Protein (NBP1-87223PEP) (0)

There are no reviews for Urotensin-2 Protein (NBP1-87223PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Urotensin-2 Protein (NBP1-87223PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Urotensin-2 Products

Research Areas for Urotensin-2 Protein (NBP1-87223PEP)

Find related products by research area.

Blogs on Urotensin-2

There are no specific blogs for Urotensin-2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Urotensin-2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UTS2