![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human lymph node.](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0008.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human lymph node.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NME9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Glutaredoxin 3/GLRX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glutaredoxin_3_AF7560_Immunohistochemistry_22502.jpg)
![Western Blot Glutaredoxin 3/GLRX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glutaredoxin_3_AF7560_Western_Blot_12315.jpg)
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TXNDC6 Antibody (NBP2-48719)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NME9 |
![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human fallopian tube shows distinct positivity in glandular cells.](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0002.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human fallopian tube shows distinct positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0003.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human colon shows low expression as expected.")
![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0004.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining in human fallopian tube and colon tissues using anti-NME9 antibody. Corresponding NME9 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0005.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining in human fallopian tube and colon tissues using anti-NME9 antibody. Corresponding NME9 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human cerebral cortex, fallopian tube, lymph node and testis using Anti-NME9 antibody NBP2-48719 (A) shows similar protein distribution across tissues to independent antibody NBP2-48802 (B).](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0006.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human cerebral cortex, fallopian tube, lymph node and testis using Anti-NME9 antibody NBP2-48719 (A) shows similar protein distribution across tissues to independent antibody NBP2-48802 (B).")
![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0007.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human testis.](http://images.novusbio.com/fullsize/TXNDC6-Antibody-Immunohistochemistry-Paraffin-NBP2-48719-img0009.jpg "Immunohistochemistry-Paraffin: TXNDC6 Antibody [NBP2-48719] - Staining of human testis.")
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/MMP-13_DM1300_ELISA_136.jpg)
![N/A MMP-13 [HRP]](https://images.novusbio.com/images2/DATA_MMP13_DM1300_ELISA_751.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")