| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 439-538 of Human Tubby Source: Wheat Germ (in vitro) Amino Acid Sequence: KMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYN |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | TUB |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Tubby Partial Recombinant Protein (H00007275-Q01)Find related products by research area.
|
|
Auditory Infographic: Can you hear me now? The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below. Novus Biologicals offers reagents mentioned in the inf... Read full blog post. |
|
Can Tubby Make You Tubby? The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TUB |
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Flow_Cytometry_3467.jpg)
![Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunocytochemistry_12010.jpg)
![Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunohistochemistry_12592.jpg)
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images2/Leptin_R_AF497_Immunohistochemistry_6850.jpg)
![Western Blot Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-41202410481130.jpg)
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-immunohistochemistry-251120248493..jpg)
