Home » Tryptase gamma-1/TPSG1 » Tryptase gamma-1/TPSG1 Proteins » Tryptase gamma-1/TPSG1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Tryptase gamma-1/TPSG1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Tryptase gamma-1/TPSG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPSG1.

Source: E. coli

Amino Acid Sequence: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPSG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37977.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.-
  • gamma I
  • gamma II
  • lung tryptase
  • mast cell protease II
  • mast cell tryptase
  • PRSS31skin tryptase
  • Serine protease 31
  • TMTpituitary tryptase
  • TPSG1
  • Transmembrane tryptase
  • trpA
  • tryptase gamma 1
  • tryptase gamma I
  • tryptase gamma II
  • tryptase gamma
  • Tryptase gamma1
  • Tryptase gamma-1

Background

Mast cells contain a number of preformed chemical mediators such as histamine, chymase, carboxypeptidase and proteolytic tryptase. Human Mast Cell Tryptase is considered to be an important marker of mast cell activation as well as an important mediator of inflammation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tryptase
alpha/beta 1 Antibody
NBP2-26444
Immunohistochemistry-Paraffin Tryptase alpha/beta 1 Antibody (AA1)
Immunohistochemistry-Paraffin Tryptase alpha/beta 1 Antibody (AA1)
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
Chymase/CMA1/Mast
Cell Chymase Antibody ...
MAB4099
Western Blot Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]
ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]
(2 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, IP, WB
TYRP1 Antibody
NBP1-88370
Western Blot TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
TBP like protein
TLP Antibody
NBP2-49671
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAR2 Antibody
(344222) [Unconjugate
MAB3949
Flow Cytometry PAR2 Antibody (344222) [Unconjugated]
Flow Cytometry PAR2 Antibody (344222) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
TRAIL/TNFSF10
[Unconjugated]
375-TL
TRAIL/TNFSF10 [Unconjugated]
(1 Review)
(54 Publications)
Species: Hu
Applications: BA
RNASE3 Antibody
NBP2-33778
Western Blot RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(201 Publications)
Species: Hu
Applications: BA
Cathepsin G
Antibody
NBP2-33498
Immunohistochemistry-Paraffin Cathepsin G Antibody
Immunohistochemistry-Paraffin Cathepsin G Antibody
Immunohistochemistry-Paraffin Cathepsin G Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Neutrophil
Elastase/ELA2 [Biotin
DY4517-05
N/A Neutrophil Elastase/ELA2 [Biotin]
(15 Publications)
Species: Mu
Applications: ELISA
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
JTB Antibody
NBP1-81746
Western Blot JTB Antibody
Immunocytochemistry/ Immunofluorescence JTB Antibody
Immunohistochemistry-Paraffin JTB Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
Tryptase
gamma-1/TPSG1 Recombi ...
NBP2-37977PEP
Tryptase gamma-1/TPSG1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP) (0)

There are no publications for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP) (0)

There are no reviews for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tryptase gamma-1/TPSG1 Recombinant Protein Antigen (NBP2-37977PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tryptase gamma-1/TPSG1 Products

Blogs on Tryptase gamma-1/TPSG1

There are no specific blogs for Tryptase gamma-1/TPSG1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tryptase gamma-1/TPSG1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TPSG1