![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining in human skin and skeletal muscle tissues using anti-DCT antibody. Corresponding DCT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0007.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining in human skin and skeletal muscle tissues using anti-DCT antibody. Corresponding DCT RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Ca, EqSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-86892 | Applications | Species |
|---|---|---|
| Ponten F, Jirstrom K, Uhlen M. The Human Protein Atlas--a tool for pathology. J Pathol 2008-12-01 [PMID: 18853439] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
IHC-P | Equine | 10/29/2021 |
Summary
Comments
|
|||||||||||
|
reviewed by:
Verified Customer |
IHC-P | Canine | 10/29/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TRP2 Antibody (NBP1-86892)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 10/29/2021 |
||
| Application: | IHC-P | |
| Species: | Equine |
| Verified Customer 10/29/2021 |
||
| Application: | IHC-P | |
| Species: | Canine |
| Gene Symbol | DCT |
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-TRP2 antibody NBP1-86892 (A) shows similar protein distribution across tissues to independent antibody NBP1-86893 (B).](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0014.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-TRP2 antibody NBP1-86892 (A) shows similar protein distribution across tissues to independent antibody NBP1-86893 (B).")
![Western Blot: TRP2 Antibody [NBP1-86892] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.](http://images.novusbio.com/fullsize/TRP2-Antibody-Western-Blot-NBP1-86892-img0013.jpg "Western Blot: TRP2 Antibody [NBP1-86892] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in equine skin. Tissue sections were incubated with primary antibody for 30 minutes at room temperature. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0017.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in equine skin. Tissue sections were incubated with primary antibody for 30 minutes at room temperature. IHC-P image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0003.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0006.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human lymph node.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0010.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0011.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human testis.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0012.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human testis.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0015.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in canine skin. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/fullsize/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0016.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in canine skin. IHC-P image submitted by a verified customer review.")
![Immunohistochemistry Trypsin 1/PRSS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Trypsin_1_AF3848_Immunohistochemistry_17574.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
