![Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining in human skeletal muscle and heart muscle tissues using anti-TNNI2 antibody. Corresponding TNNI2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Troponin-I-type-2-fast-skeletal-Antibody-Immunohistochemistry-Paraffin-NBP2-38775-img0008.jpg "Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining in human skeletal muscle and heart muscle tissues using anti-TNNI2 antibody. Corresponding TNNI2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK |
| Predicted Species | Mouse (90%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TNNI2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Troponin I type 2 (fast skeletal) Antibody (NBP2-38775)Find related products by research area.
|
|
Troponin I Type 2 - I stay with fast-twitch skeletal muscles only The protein Troponin I is a component of the heteromeric protein complex responsible for regulating both skeletal and cardiac muscle contraction. Troponin complex is made up of three parts: troponin I (TnI), troponin T (TnT), and troponin C (TnC). Eac... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/Troponin-I-type-2-fast-skeletal-Antibody-Western-Blot-NBP2-38775-img0002.jpg "Western Blot: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunocytochemistry/Immunofluorescence: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human cell line hTCEpi shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Troponin-I-type-2-fast-skeletal-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38775-img0010.jpg "Immunocytochemistry/Immunofluorescence: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human cell line hTCEpi shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human heart muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Troponin-I-type-2-fast-skeletal-Antibody-Immunohistochemistry-Paraffin-NBP2-38775-img0006.jpg "Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human heart muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/Troponin-I-type-2-fast-skeletal-Antibody-Immunohistochemistry-Paraffin-NBP2-38775-img0007.jpg "Immunohistochemistry-Paraffin: Troponin I type 2 (fast skeletal) Antibody [NBP2-38775] - Staining of human skeletal muscle shows high expression.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")