![Western Blot: Tropomodulin 3 Antibody [NBP1-86870] - Analysis in human cell lines A-549 and HEK293 using anti-TMOD3 antibody. Corresponding TMOD3 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.](http://images.novusbio.com/fullsize/Tropomodulin-3-Antibody-Western-Blot-NBP1-86870-img0016.jpg "Western Blot: Tropomodulin 3 Antibody [NBP1-86870] - Analysis in human cell lines A-549 and HEK293 using anti-TMOD3 antibody. Corresponding TMOD3 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMOD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-86870 | Applications | Species |
|---|---|---|
| D C Singleton, P Rouhi, C E Zois et al. Hypoxic regulation of RIOK3 is a major mechanism for cancer cell invasion and metastasis. Oncogene 2014-12-08 [PMID: 25486436] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMOD3 |
![Immunocytochemistry/Immunofluorescence: Tropomodulin 3 Antibody [NBP1-86870] - Staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Tropomodulin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86870-img0010.jpg "Immunocytochemistry/Immunofluorescence: Tropomodulin 3 Antibody [NBP1-86870] - Staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Tropomodulin 3 Antibody [NBP1-86870] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Tropomodulin-3-Antibody-Immunohistochemistry-Paraffin-NBP1-86870-img0015.jpg "Immunohistochemistry-Paraffin: Tropomodulin 3 Antibody [NBP1-86870] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: Tropomodulin 3 Antibody [NBP1-86870] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/Tropomodulin-3-Antibody-Western-Blot-NBP1-86870-img0011.jpg "Western Blot: Tropomodulin 3 Antibody [NBP1-86870] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")