![Western Blot: TRIM49 Antibody (2E5) [H00057093-M01] - TRIM49 expression in PC-12 ( Cat # L012V1 ).](http://images.novusbio.com/fullsize/TRIM49-Antibody-2E5-Western-Blot-H00057093-M01-img0001.jpg "Western Blot: TRIM49 Antibody (2E5) [H00057093-M01] - TRIM49 expression in PC-12 ( Cat # L012V1 ).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 2E5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | TRIM49 (NP_065091, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK |
| Specificity | TRIM49 (2E5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TRIM49 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRIM49 Antibody (H00057093-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TRIM49 Antibody (2E5) [H00057093-M01] - Analysis of monoclonal antibody to TRIM49 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/TRIM49-Antibody-2E5-Immunohistochemistry-Paraffin-H00057093-M01-img0005.jpg "Immunohistochemistry-Paraffin: TRIM49 Antibody (2E5) [H00057093-M01] - Analysis of monoclonal antibody to TRIM49 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.")
![Sandwich ELISA: TRIM49 Antibody (2E5) [H00057093-M01] - Detection limit for recombinant GST tagged TRIM49 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TRIM49-Antibody-2E5-Sandwich-ELISA-H00057093-M01-img0006.jpg "Sandwich ELISA: TRIM49 Antibody (2E5) [H00057093-M01] - Detection limit for recombinant GST tagged TRIM49 is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
