Novus Biologicals products are now on bio-techne.com

TPSD1 Recombinant Protein Antigen

Images

 
There are currently no images for TPSD1 Protein (NBP2-31981PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

TPSD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPSD1.

Source: E. coli

Amino Acid Sequence: NVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPSD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31981.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TPSD1 Recombinant Protein Antigen

  • Delta-tryptase
  • EC 3.4.21
  • EC 3.4.21.59
  • HmMCP-3-like tryptase III
  • Mast cell mMCP-7-like
  • mast cell tryptase
  • MCP7L1
  • MCP7-LIKE
  • MGC95428
  • MMCP-7L
  • mMCP-7-like delta II tryptase
  • mMCP-7-like-1
  • mMCP-7-like-2
  • TPSD1
  • tryptase delta 1
  • tryptase delta
  • Tryptase-3

Background

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. Although this gene may be an exception, most of the tryptase genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. This gene was once considered to be a pseudogene, although it is now believed to be a functional gene that encodes a protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
MAB3949
Species: Hu
Applications: CyTOF-ready, Flow
MAB4099
Species: Hu
Applications: ELISA, IP, WB
NBP2-26444
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-33778
Species: Hu
Applications: IHC, IHC-P, WB
255-SC
Species: Hu
Applications: BA
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00055065-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-683
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DY4517-05
Species: Mu
Applications: ELISA
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF3998
Species: Hu
Applications: WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC

Publications for TPSD1 Protein (NBP2-31981PEP) (0)

There are no publications for TPSD1 Protein (NBP2-31981PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPSD1 Protein (NBP2-31981PEP) (0)

There are no reviews for TPSD1 Protein (NBP2-31981PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TPSD1 Protein (NBP2-31981PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TPSD1 Products

Array NBP2-31981PEP

Blogs on TPSD1

There are no specific blogs for TPSD1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TPSD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPSD1