![Western Blot: TPD52L1/D53 Antibody [NBP1-84313] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7](http://images.novusbio.com/fullsize/TPD52L1-D53-Antibody-Western-Blot-NBP1-84313-img0005.jpg "Western Blot: TPD52L1/D53 Antibody [NBP1-84313] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEI |
| Predicted Species | Mouse (94%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TPD52L1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TPD52L1/D53 Antibody (NBP1-84313)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TPD52L1 |
![Immunocytochemistry/Immunofluorescence: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol and cell junctions.](http://images.novusbio.com/fullsize/TPD52L1-D53-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84313-img0010.jpg "Immunocytochemistry/Immunofluorescence: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol and cell junctions.")
![Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining in human salivary gland and lymph node tissues using anti-TPD52L1 antibody. Corresponding TPD52L1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TPD52L1-D53-Antibody-Immunohistochemistry-Paraffin-NBP1-84313-img0009.jpg "Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining in human salivary gland and lymph node tissues using anti-TPD52L1 antibody. Corresponding TPD52L1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/TPD52L1-D53-Antibody-Immunohistochemistry-Paraffin-NBP1-84313-img0007.jpg "Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human salivary gland shows high expression.](http://images.novusbio.com/fullsize/TPD52L1-D53-Antibody-Immunohistochemistry-Paraffin-NBP1-84313-img0008.jpg "Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84313] - Staining of human salivary gland shows high expression.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")