![Western Blot: TOMM40 Antibody [NBP2-38289] - Analysis in human cell line U-251 MG.](http://images.novusbio.com/fullsize/TOMM40-Antibody-Western-Blot-NBP2-38289-img0009.jpg "Western Blot: TOMM40 Antibody [NBP2-38289] - Analysis in human cell line U-251 MG.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOMM40 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-38289 | Applications | Species |
|---|---|---|
| Elcocks H, Brazel AJ, McCarron KR et al. FBXL4 ubiquitin ligase deficiency promotes mitophagy by elevating NIX levels The EMBO journal 2023-04-27 [PMID: 37102372] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TOMM40 Antibody (NBP2-38289)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TOMM40 Antibody [NBP2-38289] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TOMM40-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38289-img0004.jpg "Immunocytochemistry/Immunofluorescence: TOMM40 Antibody [NBP2-38289] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human tonsil shows strong granular positivity in cytoplasm in germinal center cells.](http://images.novusbio.com/fullsize/TOMM40-Antibody-Immunohistochemistry-Paraffin-NBP2-38289-img0008.jpg "Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human tonsil shows strong granular positivity in cytoplasm in germinal center cells.")
![Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human cerebral cortex shows weak granular positivity in cytoplasm in neurons.](http://images.novusbio.com/fullsize/TOMM40-Antibody-Immunohistochemistry-Paraffin-NBP2-38289-img0005.jpg "Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human cerebral cortex shows weak granular positivity in cytoplasm in neurons.")
![Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human colon shows strong granular positivity in cytoplasm in glandular cells.](http://images.novusbio.com/fullsize/TOMM40-Antibody-Immunohistochemistry-Paraffin-NBP2-38289-img0006.jpg "Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human colon shows strong granular positivity in cytoplasm in glandular cells.")
![Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human Fallopian tube shows moderate granular positivity in cytoplasm in glandular cells.](http://images.novusbio.com/fullsize/TOMM40-Antibody-Immunohistochemistry-Paraffin-NBP2-38289-img0007.jpg "Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human Fallopian tube shows moderate granular positivity in cytoplasm in glandular cells.")
![Immunohistochemistry GIP Antibody (911205) [Unconjugated]](https://images.novusbio.com/images2/GIP_MAB8864_Immunohistochemistry_17088.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")