Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.Lane 1: TOMM20 transfected lysate(16.3 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH and TOMM20in C6 glioma. A small glioma labeled with an antibody against Tom20. The brightness and contrast have been increased. Image ...read more
Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3 Analysis of TOMM20 expression in HeLa.
Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in PC-12.
Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in NIH/3T3.
Immunohistochemistry-Paraffin: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
ELISA: TOMM20 Antibody (4F3) [H00009804-M01] - Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH & Tom20 in C6 gliomas. a A section of rat brain stained with hematoxilin & eosin to show a glioma produced by ...read more
TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Localization
Mitochondrion outer membrane; Multi-pass membrane protein
Specificity
TOMM20 - translocase of outer mitochondrial membrane 20 homolog (yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TOMM20
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
translocase of outer mitochondrial membrane 20 homolog (yeast)
translocase of outer mitochondrial membrane 20 homolog type II
Background
Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TOMM20 Antibody (4F3) and receive a gift card or discount.
![Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.Lane 1: TOMM20 transfected lysate(16.3 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-Western-Blot-H00009804-M01-img0016.jpg "Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.Lane 1: TOMM20 transfected lysate(16.3 KDa).Lane 2: Non-transfected lysate.")
![Immunocytochemistry/Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-Immunocytochemistry-Immunofluorescence-H00009804-M01-img0009.jpg "Immunocytochemistry/Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH and TOMM20in C6 glioma. A small glioma labeled with an antibody against Tom20. The brightness and contrast have been increased. Image collected and cropped by CiteAb from the following publication (//www.biomedcentral.com/1756-0500/8/207), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-Immunohistochemistry-H00009804-M01-img0018.jpg "Immunohistochemistry: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH and TOMM20in C6 glioma. A small glioma labeled with an antibody against Tom20. The brightness and contrast have been increased. Image collected and cropped by CiteAb from the following publication (//www.biomedcentral.com/1756-0500/8/207), licensed under a CC-BY license.")
![Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3 Analysis of TOMM20 expression in HeLa.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-Western-Blot-H00009804-M01-img0013.jpg "Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3 Analysis of TOMM20 expression in HeLa.")
![Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in PC-12.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-Western-Blot-H00009804-M01-img0014.jpg "Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in PC-12.")
![Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in NIH/3T3.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-Western-Blot-H00009804-M01-img0015.jpg "Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - TOMM20 monoclonal antibody (M01), clone 4F3. Analysis of TOMM20 expression in NIH/3T3.")
![Immunohistochemistry-Paraffin: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-Immunohistochemistry-Paraffin-H00009804-M01-img0011.jpg "Immunohistochemistry-Paraffin: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.")
![ELISA: TOMM20 Antibody (4F3) [H00009804-M01] - Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TOMM20-Antibody-4F3-ELISA-H00009804-M01-img0017.jpg "ELISA: TOMM20 Antibody (4F3) [H00009804-M01] - Detection limit for recombinant GST tagged TOMM20 is approximately 0.1ng/ml as a capture antibody.")
![Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH & Tom20 in C6 gliomas. a A section of rat brain stained with hematoxilin & eosin to show a glioma produced by implantation of C6 cells in the right caudate nucleus. In this case, cells also grew in the region of the syringe needle track through the cortex. (b–d). A small glioma labeled by bisbenzamide (b) & with antibodies against Tom20 (c) & GAPDH (d). The brightness & contrast have been increased. e Illustration of a strip perpendicular to the rim of a glioma (labeled with bisbenzamide) & along which intensity profiles were measured. f, g Tom20 & GAPDH fluorescence along such a strip (barely visible without enhancement). The graphs show the raw intensity values given by ImageJ. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26032618), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00009804-m01_mouse-monoclonal-tomm20-antibody-4f3-310202415175285.jpg "Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH & Tom20 in C6 gliomas. a A section of rat brain stained with hematoxilin & eosin to show a glioma produced by implantation of C6 cells in the right caudate nucleus. In this case, cells also grew in the region of the syringe needle track through the cortex. (b–d). A small glioma labeled by bisbenzamide (b) & with antibodies against Tom20 (c) & GAPDH (d). The brightness & contrast have been increased. e Illustration of a strip perpendicular to the rim of a glioma (labeled with bisbenzamide) & along which intensity profiles were measured. f, g Tom20 & GAPDH fluorescence along such a strip (barely visible without enhancement). The graphs show the raw intensity values given by ImageJ. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26032618), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry GIP Antibody (911205) [Unconjugated]](https://images.novusbio.com/images2/GIP_MAB8864_Immunohistochemistry_17088.jpg)
![C1qTNF1/CTRP1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "C1qTNF1/CTRP1 Antibody [Unconjugated]")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")