TLR5 Antibody (6P1Q10) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 258-404 of human TLR5 (O60602). LILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPS |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
TLR5 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for TLR5 Antibody (6P1Q10)
Background
The Toll like receptor (TLR) family in mammal comprises a family of transmembrane proteins characterized by multiple copies of leucine rich repeats in the extracellular domain and IL1 receptor motif in the cytoplasmic domain. Like its counterparts in Drosophila, TLRs signal through adaptor molecules and could constitute an important and unrecognized component of innate immunity in humans. The TRL family is a phylogenetically conserved mediator of innate immunity that is essential for microbial recognition. TLRs characterized so far activate the MyD88/interleukin 1 receptor-associated kinase (IRAK) signaling pathway. Toll-like receptor 5 (TLR5) expression is upregulated following exposure to bacteria or to the TLR5 agonist, flagellin. Gram-negative bacteria, stimulate monocyte/macrophage cells in a TLR5-specific, CD14-independent manner. The TLR5 receptor thus appears to be the principal means by which the innate immune system recognizes flagellated bacterial pathogens.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rb
Applications: CyTOF-ready, DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for TLR5 Antibody (NBP3-16698) (0)
There are no publications for TLR5 Antibody (NBP3-16698).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TLR5 Antibody (NBP3-16698) (0)
There are no reviews for TLR5 Antibody (NBP3-16698).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TLR5 Antibody (NBP3-16698) (0)