Home » TID1 » TID1 Proteins » TID1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TID1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TID1 Protein (NBP2-34066PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TID1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJA3.

Source: E. coli

Amino Acid Sequence: DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAJA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34066.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TID1 Recombinant Protein Antigen

  • DnaJ (Hsp40) homolog, subfamily A, member 3
  • DnaJ protein Tid-1
  • HCA57
  • Hepatocellular carcinoma-associated antigen 57
  • hTid-1FLJ45758
  • TID1dnaJ homolog subfamily A member 3, mitochondrial
  • tumorous imaginal discs homolog
  • Tumorous imaginal discs protein Tid56 homolog

Background

DNAJA3 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins. For background information on the DNAJ family, see MIM 608375.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DNAJA2 Antibody
(OTI3A10)
NBP2-02996
Flow Cytometry DNAJA2 Antibody (OTI3A10)
Western Blot DNAJA2 Antibody (OTI3A10)
Immunohistochemistry-Paraffin DNAJA2 Antibody (OTI3A10)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DNAJB6 Antibody
(2C11-C1)
H00010049-M01
ELISA DNAJB6 Antibody (2C11-C1)
Western Blot DNAJB6 Antibody (2C11-C1)
Western Blot DNAJB6 Antibody (2C11-C1)
(9 Publications)
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
HspA4 Antibody
NBP1-81696
Western Blot HspA4 Antibody
Immunohistochemistry-Paraffin HspA4 Antibody
Western Blot HspA4 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ATRX Antibody
NBP1-83077
Immunohistochemistry-Paraffin ATRX Antibody
Immunohistochemistry-Paraffin ATRX Antibody
Immunohistochemistry-Paraffin ATRX Antibody
(26 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
RAD54B Antibody
NBP1-83417
Immunohistochemistry-Paraffin RAD54B Antibody
Immunohistochemistry-Paraffin RAD54B Antibody
Immunohistochemistry-Paraffin RAD54B Antibody
Species: Hu
Applications: IHC, IHC-P
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(66 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HSP40/DNAJB1
Antibody (OTI1F9)
NBP2-03433
Flow Cytometry HSP40/DNAJB1 Antibody (OTI1F9)
Immunocytochemistry/ Immunofluorescence HSP40/DNAJB1 Antibody (OTI1F9)
Immunohistochemistry-Paraffin HSP40/DNAJB1 Antibody (OTI1F9)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HSPA8/HSC71/Hsc70
Antibody (13D3)
NB120-2788
Immunocytochemistry/ Immunofluorescence HSPA8/HSC71/Hsc70 Antibody (13D3)
Immunocytochemistry/ Immunofluorescence HSPA8/HSC71/Hsc70 Antibody (13D3)
Immunocytochemistry/ Immunofluorescence HSPA8/HSC71/Hsc70 Antibody (13D3)
(2 Reviews)
(28 Publications)
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
RAD52 Antibody
NBP2-58116
Western Blot RAD52 Antibody
Immunocytochemistry/ Immunofluorescence RAD52 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, KD, WB
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
HID1 Antibody
(OTI2F4)
NBP2-02667
Western Blot HID1 Antibody (OTI2F4)
Flow Cytometry HID1 Antibody (OTI2F4)
Flow Cytometry HID1 Antibody (OTI2F4)
(3 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DMC1 Antibody
(1D12/4)
NB100-181
Western Blot DMC1 Antibody (1D12/4)
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: IP, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB

Publications for TID1 Protein (NBP2-34066PEP) (0)

There are no publications for TID1 Protein (NBP2-34066PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TID1 Protein (NBP2-34066PEP) (0)

There are no reviews for TID1 Protein (NBP2-34066PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TID1 Protein (NBP2-34066PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TID1 Products

Research Areas for TID1 Protein (NBP2-34066PEP)

Find related products by research area.

Blogs on TID1

There are no specific blogs for TID1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Rad51 Antibody (14B4)
NB100-148

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TID1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DNAJA3