Home » TFF1/pS2 » pS2 Peptides and Proteins » TFF1/pS2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TFF1/pS2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TFF1/pS2 Protein (NBP1-90813PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TFF1/pS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TFF1.

Source: E. coli

Amino Acid Sequence: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TFF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90813.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TFF1/pS2 Recombinant Protein Antigen

  • BCEI
  • BCEIbreast cancer, estrogen-inducible sequence expressed in
  • Breast cancer estrogen-inducible protein
  • breast cancer estrogen-inducible sequence
  • D21S21
  • gastrointestinal trefoil protein pS2
  • hP1.A
  • HPS2
  • PNR-2
  • Polypeptide P1.A
  • Protein pS2
  • PS2
  • TFF1
  • trefoil factor 1
  • trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A

Background

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Presenilin-2
Antibody (APS 26)
NB100-74513
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Immunocytochemistry/ Immunofluorescence Presenilin-2 Antibody (APS 26)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
TFF3 [HRP]
DTFF30
N/A TFF3 [HRP]
N/A TFF3 [HRP]
(8 Publications)
Species: Hu
Applications: ELISA
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Cathepsin D
Antibody [Unconjugate
AF1029
Immunohistochemistry Cathepsin D Antibody [Unconjugated]
Immunocytochemistry Cathepsin D Antibody [Unconjugated]
Western Blot Cathepsin D Antibody [Unconjugated]
(54 Publications)
Species: Mu
Applications: ICC, IHC, IP, WB
TMEM37 Antibody
NBP2-47602
Immunocytochemistry/ Immunofluorescence TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(834 Publications)
Species: Hu
Applications: BA
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ER beta/NR3A2
Antibody (14C8)
NB200-305
Immunohistochemistry-Paraffin ER beta/NR3A2 Antibody (14C8)
Immunohistochemistry-Paraffin ER beta/NR3A2 Antibody (14C8)
Western Blot ER beta/NR3A2 Antibody (14C8)
(78 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western Blot BRCA2 Antibody (234403) [Unconjugated]
Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]
Western Blot BRCA2 Antibody (234403) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
TFF1/pS2
Recombinant Protein A
NBP1-90813PEP
TFF1/pS2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TFF1/pS2 Protein (NBP1-90813PEP) (0)

There are no publications for TFF1/pS2 Protein (NBP1-90813PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFF1/pS2 Protein (NBP1-90813PEP) (0)

There are no reviews for TFF1/pS2 Protein (NBP1-90813PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TFF1/pS2 Protein (NBP1-90813PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TFF1/pS2 Products

Research Areas for TFF1/pS2 Protein (NBP1-90813PEP)

Find related products by research area.

Blogs on TFF1/pS2

There are no specific blogs for TFF1/pS2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: TFF1/pS2 Antibody [NBP1-90813] - Staining of human liver shows low expression as expected.
TFF1/pS2 Antibody
NBP1-90813
Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
beta Amyloid Antibody (MOAB-2) - BSA Free
NBP2-13075

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TFF1/pS2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TFF1