TET1 Recombinant Protein Antigen

Images

 
There are currently no images for TET1 Recombinant Protein Antigen (NBP1-88972PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

TET1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TET1.

Source: E. coli

Amino Acid Sequence: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TET1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88972.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TET1 Recombinant Protein Antigen

  • bA119F7.1
  • CXXC finger 6
  • CXXC6
  • CXXC6FLJ10839
  • EC 1.14.11.n2
  • FLJ41442
  • KIAA1676
  • KIAA1676CXXC-type zinc finger protein 6
  • LCX
  • LCXEC 1.14.11.n2
  • Leukemia-associated protein with a CXXC domain
  • methylcytosine dioxygenase TET1
  • Ten-eleven translocation 1 gene protein
  • ten-eleven translocation-1
  • tet oncogene 1
  • TET1

Background

TET1 (Ten-eleven translocation 1), also called methylcytosine dioxygenase TET1 or CXXC6, is one of three members of the human TET protein family of alpha-ketoglutarate oxygenases which includes TET2 and TET3 (1-3). TET1 is an enzyme that plays a role in epigenetic regulation of DNA methylation by conversion of 5-methylcytosine (5mC) to 5-hydroxymethylcytosine (5hmC), and further to 5-formylcystosine (5fC) and 5-carboxylcystosine (5caC) (1-5). The human TET1 protein is 2136 amino acids in length with a theoretical molecular weight of 235 kDa (6). Primary features of the TET1 protein include an N-terminal CXXC domain responsible for binding CpG islands in DNA, and a C-terminal catalytic domain containing a Cys-rich region followed by a double-stranded beta-helix (DSBH) domain that contributes to the mC dioxygenase activity and metal binding (1,2,4,5).

Recent studies have shown a role for TET1 in mediating epigenetic changes, such as DNA methylation status, in response to environmental factors such as food and nutrition, exercise, radiation, and allergens (3). The balance between DNA methylation and demethylation is crucial in health and homeostasis (3,5). In addition to response to environmental exposures, TET1 also plays a role in different diseases and cancer subtypes where it can function as either a tumor suppressor or tumor promoter (2,5). TET1 was originally identified as a fusion partner for the mixed lineage leukemia (MLL) gene in acute myeloid leukemia (AML) (1-3). While TET1 expression is low in AML, it is highly expressed in T-cell acute lymphoblastic leukemia (T-ALL) (2). Similarly, TET1 expression is suppressed in hormone receptor positive breast cancer (HRBC) but elevated in triple negative breast cancer (2). TET1 is a potential therapeutic target in certain cancers, but due to its complex role in different signaling pathways its potential needs to be more widely studied (2). While TET1 is primarily responsible for initiating DNA demethylation, it also functions alongside 5hmc in maintaining pluripotency in embryonic stem cells (ESCs) and can serve as a marker for differentiation (1,2,4,5).

References

1. Tan L, Shi YG. Tet family proteins and 5-hydroxymethylcytosine in development and disease. Development. 2012;139(11):1895-1902. https://doi.org/10.1242/dev.070771

2. Liu W, Wu G, Xiong F, Chen Y. Advances in the DNA methylation hydroxylase TET1. Biomark Res. 2021;9(1):76. https://doi.org/10.1186/s40364-021-00331-7

3. Zhu T, Brown AP, Ji H. The Emerging Role of Ten-Eleven Translocation 1 in Epigenetic Responses to Environmental Exposures. Epigenet Insights. 2020;13:2516865720910155. https://doi.org/10.1177/2516865720910155

4. Melamed P, Yosefzon Y, David C, Tsukerman A, Pnueli L. Tet Enzymes, Variants, and Differential Effects on Function. Front Cell Dev Biol. 2018;6:22. https://doi.org/10.3389/fcell.2018.00022

5. Ma C, Seong H, Liu Y, Yu X, Xu S, Li Y. Ten-eleven translocation proteins (TETs): tumor suppressors or tumor enhancers?. Front Biosci (Landmark Ed). 2021;26(10):895-915. https://doi.org/10.52586/4996

6. Uniprot (Q8NFU7)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-86126
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32104
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP2-20602
Species: Bv, Hu, Mu, Rt, Xp
Applications: ChIP, Flow, ICC/IF, IHC-WhMt, IHC, IHC-P, IP, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-86856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
DTPA00
Species: Hu
Applications: ELISA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
233-FB
Species: Hu
Applications: BA

Publications for TET1 Recombinant Protein Antigen (NBP1-88972PEP) (0)

There are no publications for TET1 Recombinant Protein Antigen (NBP1-88972PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TET1 Recombinant Protein Antigen (NBP1-88972PEP) (0)

There are no reviews for TET1 Recombinant Protein Antigen (NBP1-88972PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TET1 Recombinant Protein Antigen (NBP1-88972PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TET1 Products

Array NBP1-88972PEP

Research Areas for TET1 Recombinant Protein Antigen (NBP1-88972PEP)

Find related products by research area.

Blogs on TET1

There are no specific blogs for TET1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TET1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TET1