![Western Blot: TCEB1 Antibody [NBP2-94131] - Analysis of extracts of various cell lines, using TCEB1 . Exposure time: 60s.](http://images.novusbio.com/fullsize/TCEB1-Antibody-Western-Blot-NBP2-94131-img0001.jpg "Western Blot: TCEB1 Antibody [NBP2-94131] - Analysis of extracts of various cell lines, using TCEB1 . Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1). MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELOC |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TCEB1 Antibody (NBP2-94131)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELOC |
![Western Blot: TCEB1 Antibody - BSA Free [TCEB1] - Western blot analysis of various lysates using TCEB1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 60s.](http://images.novusbio.com/fullsize/nbp2-94131_rabbit-polyclonal-tceb1-antibody-5220251640275.jpg "Western Blot: TCEB1 Antibody - BSA Free [TCEB1] - Western blot analysis of various lysates using TCEB1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit .Exposure time: 60s.")
![Immunohistochemistry: TCEB1 Antibody - BSA Free [TCEB1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using TCEB1 Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp2-94131_rabbit-polyclonal-tceb1-antibody-52202516321459.jpg "Immunohistochemistry: TCEB1 Antibody - BSA Free [TCEB1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using TCEB1 Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: TCEB1 Antibody - BSA Free [TCEB1] - Immunohistochemistry analysis of paraffin-embedded Human prostate using TCEB1 Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp2-94131_rabbit-polyclonal-tceb1-antibody-52202516283282.jpg "Immunohistochemistry: TCEB1 Antibody - BSA Free [TCEB1] - Immunohistochemistry analysis of paraffin-embedded Human prostate using TCEB1 Rabbit pAb (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot RACK1/GNB2L1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RACK1_AF3434_Western_Blot_5298.jpg)
![Immunocytochemistry RACK1/GNB2L1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RACK1_AF3434_Immunocytochemistry__Immunofluorescence_19362.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")