![Western Blot: TBR1 Antibody (1U1K5) [NBP3-15769] - Western blot analysis of extracts of various cell lines, using TBR1 Rabbit mAb (NBP3-15769) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/TBR1-Antibody-1U1K5-Western-Blot-NBP3-15769-img0002.jpg "Western Blot: TBR1 Antibody (1U1K5) [NBP3-15769] - Western blot analysis of extracts of various cell lines, using TBR1 Rabbit mAb (NBP3-15769) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 1U1K5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBR1 (Q16650). MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGS |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | TBR1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TBR1 Antibody (NBP3-15769)Find related products by research area.
|
|
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TBR1 |
![Immunocytochemistry/ Immunofluorescence: TBR1 Antibody (1U1K5) [NBP3-15769] - Confocal imaging of paraffin-embedded Mouse brain using TBR1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15769_rabbit-tbr1-mab-1u1k5-82202520984.jpg "Immunocytochemistry/ Immunofluorescence: TBR1 Antibody (1U1K5) [NBP3-15769] - Confocal imaging of paraffin-embedded Mouse brain using TBR1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunohistochemistry Reelin Antibody [Unconjugated]](https://images.novusbio.com/images2/Reelin_AF3820_Immunohistochemistry_18505.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-285202411422.jpg)
![Immunohistochemistry Neurogenin-2 Antibody (7G4) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3314_human-rat-neurogenin-2-mab-clone-7g4-immunohistochemistry-285202411531..jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Immunocytochemistry NeuroD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NeuroD1_AF2746_Immunocytochemistry_7291.jpg)
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")