![Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1. Analysis of STXBP1 expression in NIH/3T3.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-6D1-Western-Blot-H00006812-M01-img0016.jpg "Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1. Analysis of STXBP1 expression in NIH/3T3.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 6D1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | STXBP1 (NP_003156, 74 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI |
| Specificity | STXBP1 (6D1) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | STXBP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Syntaxin-BP1 Antibody (H00006812-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Analysis of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-6D1-Immunohistochemistry-Paraffin-H00006812-M01-img0012.jpg "Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Analysis of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml.")
![Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1 Analysis of STXBP1 expression in HeLa.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-6D1-Western-Blot-H00006812-M01-img0014.jpg "Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1 Analysis of STXBP1 expression in HeLa.")
![Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1. Analysis of STXBP1 expression in Raw 264.7.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-6D1-Western-Blot-H00006812-M01-img0015.jpg "Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1. Analysis of STXBP1 expression in Raw 264.7.")
![Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Analysis of STXBP1 expression in transfected 293T cell line by STXBP1 monoclonal antibody (M01), clone 6D1.Lane 1: STXBP1 transfected lysate (Predicted MW: 68.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-6D1-Western-Blot-H00006812-M01-img0017.jpg "Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Analysis of STXBP1 expression in transfected 293T cell line by STXBP1 monoclonal antibody (M01), clone 6D1.Lane 1: STXBP1 transfected lysate (Predicted MW: 68.7 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Detection limit for recombinant GST tagged STXBP1 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Syntaxin-BP1-Antibody-6D1-Sandwich-ELISA-H00006812-M01-img0013.jpg "Sandwich ELISA: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Detection limit for recombinant GST tagged STXBP1 is approximately 0.3ng/ml as a capture antibody.")
![Immunocytochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunocytochemistry_6578.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images2/SCGF_MAB1904_Immunohistochemistry_6959.jpg)
![Immunohistochemistry SCGF/CLEC11a Antibody (239029) [Unconjugated]](https://images.novusbio.com/images/mab1904_human-scgf-clec11a-mab-clone-239029-4120241252123.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
