![Western Blot: Syntaxin 16 Antibody [NBP1-92467] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MCF-7](http://images.novusbio.com/fullsize/Syntaxin-16-Antibody-Western-Blot-NBP1-92467-img0009.jpg "Western Blot: Syntaxin 16 Antibody [NBP1-92467] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MCF-7")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHR |
| Marker | Trans-Golgi Marker |
| Predicted Species | Mouse (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STX16 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publication using NBP1-92467 | Applications | Species |
|---|---|---|
| Gu Y, Princely Y, Kumar S et al. Mammalian Atg8 proteins regulate lysosome and autolysosome biogenesis through SNAREs. EMBO J. 2019-10-18 [PMID: 31625181] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STX16 |
![Immunocytochemistry/Immunofluorescence: Syntaxin 16 Antibody [NBP1-92467] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Syntaxin-16-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92467-img0008.jpg "Immunocytochemistry/Immunofluorescence: Syntaxin 16 Antibody [NBP1-92467] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Syntaxin 16 Antibody [NBP1-92467] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/Syntaxin-16-Antibody-Immunohistochemistry-Paraffin-NBP1-92467-img0005.jpg "Immunohistochemistry-Paraffin: Syntaxin 16 Antibody [NBP1-92467] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.")
![Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Simple Western lane view shows a specific band for Syntaxin 16 in 0.2 mg/ml of MCF-7 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://images.novusbio.com/fullsize/Syntaxin-16-Antibody-Simple-Western-NBP1-92467-img0006.jpg "Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Simple Western lane view shows a specific band for Syntaxin 16 in 0.2 mg/ml of MCF-7 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.")
![Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Electropherogram image of the corresponding Simple Western lane view. Syntaxin 16 antibody was used at 1:100 dilution on MCF-7 lysate(s) respectively.](http://images.novusbio.com/fullsize/Syntaxin-16-Antibody-Simple-Western-NBP1-92467-img0007.jpg "Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Electropherogram image of the corresponding Simple Western lane view. Syntaxin 16 antibody was used at 1:100 dilution on MCF-7 lysate(s) respectively.")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry SOX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX3_AF2569_Immunocytochemistry_9767.jpg)
![Immunocytochemistry SOX3 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2569_human-sox3-affinity-purified-polyclonal-ab-immunocytochemistry-2010202310230.jpg)
![Western Blot SOX3 Antibody [Unconjugated]](https://images.novusbio.com/images/af2569_human-sox3-affinity-purified-polyclonal-ab-8120255534744.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")