Home » Synaptobrevin homolog YKT6 » Synaptobrevin homolog YKT6 Proteins » Synaptobrevin homolog YKT6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Synaptobrevin homolog YKT6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Synaptobrevin homolog YKT6 Protein (NBP1-87439PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Synaptobrevin homolog YKT6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YKT6.

Source: E. coli

Amino Acid Sequence: LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
YKT6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87439.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Synaptobrevin homolog YKT6 Recombinant Protein Antigen

  • EC 2.3.1
  • EC 2.3.1.-
  • R-SNARE
  • S. cerevisiae, homolog of
  • SNARE protein Ykt6
  • synaptobrevin homolog YKT6
  • YKT6 v-SNARE homolog (S. cerevisiae)
  • YKT6 v-SNARE protein

Background

The Synaptobrevin homolog YKT6 gene product is one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments. It is a membrane associated, isoprenylated protein that functions at the endoplasmic reticulum-Golgi transport step. This protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

VAMP-7 Antibody
(549115)
MAB6117
Western Blot VAMP-7 Antibody (549115)
Western Blot VAMP-7 Antibody (549115)
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
NSF Antibody
NBP1-87035
Immunocytochemistry/ Immunofluorescence NSF Antibody
Immunohistochemistry-Paraffin NSF Antibody
Western Blot NSF Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Use1/UBE2Z Antibody
NBP1-82785
Western Blot Use1/UBE2Z Antibody
Immunohistochemistry-Paraffin Use1/UBE2Z Antibody
Immunohistochemistry-Paraffin Use1/UBE2Z Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Syntaxin 5
Antibody [Unconjugate
AF5687
Simple Western Syntaxin 5 Antibody [Unconjugated]
Western Blot Syntaxin 5 Antibody [Unconjugated]
Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
VTI1B Antibody
NBP2-33414
Western Blot VTI1B Antibody
Immunohistochemistry-Paraffin VTI1B Antibody
Immunocytochemistry/ Immunofluorescence VTI1B Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VAMP3/Cellubrevin
Antibody
NB300-510
Western Blot VAMP3/Cellubrevin Antibody
Western Blot VAMP3/Cellubrevin Antibody
Western Blot VAMP3/Cellubrevin Antibody
(11 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
GOSR1 Antibody
H00009527-B01P
Immunocytochemistry/ Immunofluorescence GOSR1 Antibody
Western Blot GOSR1 Antibody
Western Blot GOSR1 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, WB
Membrin Antibody
(4HAD6)
NBP2-89025
Immunohistochemistry Membrin Antibody (4HAD6)
Western Blot Membrin Antibody (4HAD6)
Species: Ca, Ch, Ha, Hu, Pm, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VAMP-8 Antibody
[Unconjugated]
AF5354
Western Blot VAMP-8 Antibody [Unconjugated]
Immunohistochemistry VAMP-8 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, WB
VAMP-2 Antibody
NB300-595
Flow Cytometry VAMP-2 Antibody
Western Blot VAMP-2 Antibody
Western Blot VAMP-2 Antibody
(4 Publications)
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
SEC22B Antibody -
Azide and BSA Free
NB100-91277
Immunohistochemistry SEC22B Antibody - Azide and BSA Free
Immunohistochemistry SEC22B Antibody - Azide and BSA Free
Immunohistochemistry SEC22B Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
BET1 Antibody
NBP3-10803
Western Blot BET1 Antibody
Species: Hu
Applications: WB
SNAP23 Antibody
NBP2-20434
Western Blot SNAP23 Antibody
Immunocytochemistry/ Immunofluorescence SNAP23 Antibody
Western Blot SNAP23 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TMUB1 Antibody
NBP1-86731
Western Blot TMUB1 Antibody
Immunocytochemistry/ Immunofluorescence TMUB1 Antibody
Immunohistochemistry-Paraffin TMUB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Alkaline
Phosphatase/ALPL Anti ...
AF2910
Immunohistochemistry Alkaline Phosphatase/ALPL Antibody [Unconjugated]
Western Blot Alkaline Phosphatase/ALPL Antibody [Unconjugated]
Flow Cytometry Alkaline Phosphatase/ALPL Antibody [Unconjugated]
(44 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Syntaxin 4 Antibody
NBP1-87374
Immunocytochemistry/ Immunofluorescence Syntaxin 4 Antibody
Western Blot Syntaxin 4 Antibody
Immunohistochemistry-Paraffin Syntaxin 4 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Tomosyn Antibody
NBP2-56176
Immunocytochemistry/ Immunofluorescence Tomosyn Antibody
Immunohistochemistry-Paraffin Tomosyn Antibody
Immunohistochemistry-Paraffin Tomosyn Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
VAMP4 Antibody
NBP2-13512
Immunocytochemistry/ Immunofluorescence VAMP4 Antibody
Immunohistochemistry-Paraffin VAMP4 Antibody
Immunohistochemistry-Paraffin VAMP4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Synaptobrevin
homolog YKT6 Recombin ...
NBP1-87439PEP
Synaptobrevin homolog YKT6 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Synaptobrevin homolog YKT6 Protein (NBP1-87439PEP) (0)

There are no publications for Synaptobrevin homolog YKT6 Protein (NBP1-87439PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptobrevin homolog YKT6 Protein (NBP1-87439PEP) (0)

There are no reviews for Synaptobrevin homolog YKT6 Protein (NBP1-87439PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Synaptobrevin homolog YKT6 Protein (NBP1-87439PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Synaptobrevin homolog YKT6 Products

Blogs on Synaptobrevin homolog YKT6

There are no specific blogs for Synaptobrevin homolog YKT6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Synaptobrevin homolog YKT6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol YKT6