![Western Blot: SRPX Antibody [H00008406-B01P] - Analysis of SRPX expression in HeLa.](http://images.novusbio.com/fullsize/SRPX-Antibody-Western-Blot-H00008406-B01P-img0003.jpg "Western Blot: SRPX Antibody [H00008406-B01P] - Analysis of SRPX expression in HeLa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | SRPX (NP_006298.1, 1 a.a. - 464 a.a.) full-length human protein. MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT |
| Specificity | SRPX - sushi-repeat-containing protein, X-linked, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SRPX |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against transfected lysate for WB. It has been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for SRPX Antibody (H00008406-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRPX |
| Entrez |
|
| Uniprot |
|
![Western Blot: SRPX Antibody [H00008406-B01P] - Analysis of SRPX expression in transfected 293T cell line by SRPX polyclonal antibody. Lane 1: SRPX transfected lysate(51.04 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SRPX-Antibody-Western-Blot-H00008406-B01P-img0004.jpg "Western Blot: SRPX Antibody [H00008406-B01P] - Analysis of SRPX expression in transfected 293T cell line by SRPX polyclonal antibody. Lane 1: SRPX transfected lysate(51.04 KDa). Lane 2: Non-transfected lysate.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunohistochemistry DNER Antibody [Unconjugated]](https://images.novusbio.com/images2/DNER_AF2254_Immunohistochemistry_18506.jpg)
![Immunocytochemistry/ Immunofluorescence DNER Antibody [Unconjugated]](https://images.novusbio.com/images/af2254_mouse-dner-affinity-purified-polyclonal-ab-41202412394943.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")