Home » Snx6 » Snx6 Proteins » Snx6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Snx6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Snx6 Protein (NBP2-13361PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Snx6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SNX6.

Source: E. coli

Amino Acid Sequence: RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SNX6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13361.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Snx6 Recombinant Protein Antigen

  • MGC3157
  • MSTP010
  • sorting nexin 6
  • sorting nexin-6
  • TFAF2
  • TRAF4-associated factor 2
  • tumor necrosis factor receptor-associated factor 4(TRAF4)-associated factor 2

Background

The Snx6 gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associates with the long isoform of the lept

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNX1 Antibody
NB100-282
Immunohistochemistry SNX1 Antibody
Immunohistochemistry-Paraffin SNX1 Antibody
Immunohistochemistry SNX1 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TRAF-4 Antibody
NB100-56177
Immunohistochemistry-Paraffin TRAF-4 Antibody
Immunoprecipitation TRAF-4 Antibody
(1 Publication)
Species: Bv, Hu, Mu, Rt, Ze
Applications: IHC, IHC-P, IP, WB
Annexin A7 Antibody
AF3926
Western Blot Annexin A7 Antibody
Simple Western Annexin A7 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB
SNX5 Antibody
NBP2-20449
Western Blot SNX5 Antibody
Immunocytochemistry/ Immunofluorescence SNX5 Antibody
Immunohistochemistry-Paraffin SNX5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
IGF-II R/IGF2R
Antibody (2G11) - BSA ...
NB300-514
Flow Cytometry IGF-II R/IGF2R Antibody (2G11) - BSA Free
Immunocytochemistry/ Immunofluorescence IGF-II R/IGF2R Antibody (2G11) - BSA Free
Immunocytochemistry/ Immunofluorescence IGF-II R/IGF2R Antibody (2G11) - BSA Free
(12 Publications)
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
BRMS1 Antibody
(2D4-2G11)
H00025855-M01
Immunoprecipitation BRMS1 Antibody (2D4-2G11)
Sandwich ELISA BRMS1 Antibody (2D4-2G11)
Western Blot BRMS1 Antibody (2D4-2G11)
(10 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB
VPS26A Antibody -
BSA Free
NBP2-75922
Western Blot VPS26A Antibody - BSA Free
Immunohistochemistry-Paraffin VPS26A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence VPS26A Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
VPS35 Antibody
NB100-1397
Immunocytochemistry/ Immunofluorescence VPS35 Antibody
Immunohistochemistry-Paraffin VPS35 Antibody
Immunohistochemistry-Paraffin VPS35 Antibody
(5 Reviews)
(30 Publications)
Species: Ca, Ch, ChHa, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
SART3 Antibody
NB100-74648
Immunohistochemistry-Paraffin SART3 Antibody
Immunohistochemistry-Paraffin SART3 Antibody
Western Blot SART3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
OAS3 Antibody
NBP1-85841
Immunocytochemistry/ Immunofluorescence OAS3 Antibody
Immunohistochemistry-Paraffin OAS3 Antibody
Immunohistochemistry-Paraffin OAS3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RP9 Antibody
NBP1-87342
Immunohistochemistry-Paraffin RP9 Antibody
Immunocytochemistry/ Immunofluorescence RP9 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TPX2 Antibody
NB500-179
Flow Cytometry TPX2 Antibody
Simple Western TPX2 Antibody
Immunocytochemistry/ Immunofluorescence TPX2 Antibody
(1 Review)
(47 Publications)
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
LONP1 Antibody
NBP1-81734
Immunohistochemistry-Paraffin LONP1 Antibody
Immunohistochemistry-Paraffin LONP1 Antibody
Immunohistochemistry-Paraffin LONP1 Antibody
(17 Publications)
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10)
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10)
ELISA CDP/CUTL1 Antibody (2A10)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ASCC2 Antibody
(OTI1E8) - Azide and ...
NBP2-72273
Western Blot ASCC2 Antibody (OTI1E8) - Azide and BSA Free
Flow Cytometry ASCC2 Antibody (OTI1E8) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence ASCC2 Antibody (OTI1E8) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
PIM1 Antibody
NBP2-31366
Immunohistochemistry-Paraffin PIM1 Antibody
Immunohistochemistry-Paraffin PIM1 Antibody
Western Blot PIM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Snx6 Recombinant
Protein Antigen
NBP2-13361PEP
Snx6 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Snx6 Protein (NBP2-13361PEP) (0)

There are no publications for Snx6 Protein (NBP2-13361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Snx6 Protein (NBP2-13361PEP) (0)

There are no reviews for Snx6 Protein (NBP2-13361PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Snx6 Protein (NBP2-13361PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Snx6 Products

Research Areas for Snx6 Protein (NBP2-13361PEP)

Find related products by research area.

Blogs on Snx6

There are no specific blogs for Snx6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
beta Amyloid Antibody (MOAB-2) - BSA Free
NBP2-13075

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Snx6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SNX6