Novus Biologicals products are now on bio-techne.com

Recombinant Human Smoothelin GST (N-Term) Protein

Name: Recombinant Human Smoothelin GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006525-P01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Smoothelin GST (N-Term) Protein Summary

Description	A recombinant protein with GST tag at N-terminal corresponding to the amino acids 24473 of Human SMTN Source: Wheat Germ (in vitro) Amino Acid Sequence: MGPLTSFRRAPSSSPAKASSAISLAPSSVGSFLVRSPVPVAPVTSSENSAGDRHESGMLGLPETTGT
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	SMTN
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	33.11 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Smoothelin GST (N-Term) Protein

FLJ35365
FLJ38597
Smoothelin
SMSMO
SMTN

Background

SMTN( 1 a.a. - 68 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Desmin Antibody
[Unconjugated]

AF3844

Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Hu, Mu

Applications: IHC

Transgelin/TAGLN/SM22

NB600-507

Immunohistochemistry-Paraffin Transgelin/TAGLN/SM22 alpha Antibody

(1 Review)

(23 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, KD, PEP-ELISA, WB

Myocardin Antibody
(355521) [Unconjugate ...

MAB4028

(15 Publications)

Species: Hu, Mu

Applications: WB

Vimentin Antibody

NB300-223

Immunohistochemistry-Frozen Vimentin Antibody

(6 Reviews)

(70 Publications)

Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Caldesmon/CALD1
Antibody (h-CALD)

NBP2-44421

Western Blot Caldesmon/CALD1 Antibody (h-CALD)

Simple Western Caldesmon/CALD1 Antibody (h-CALD)

(1 Review)

Species: Hu

Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB

FGF
basic/FGF2/bFGF [Unco

233-FB

(552 Publications)

Species: Hu

Applications: BA

Fibronectin
Antibody - BSA Free

NBP1-91258

(11 Reviews)

(56 Publications)

Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Serum Response
Factor SRF Antibody ( ...

NBP3-13785

Immunocytochemistry/ Immunofluorescence Serum Response Factor SRF Antibody (PCRP-SRF-1F7)

Immunohistochemistry-Paraffin Serum Response Factor SRF Antibody (PCRP-SRF-1F7)

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB

CD34 Antibody
[Unconjugated]

AF4117

(3 Reviews)

(37 Publications)

Species: Rt

Applications: IHC, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Myosin Heavy Chain
Antibody (MF20) [Unco ...

MAB4470

Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]

(1 Review)

(165 Publications)

Species: All-Multi

Applications: Flow, ICC, IHC, WB

Elastin Antibody
(BA-4)

NB100-2076

(2 Reviews)

(11 Publications)

Species: Bv, Fe, Hu, Rb

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

MHC Class I
Antibody (OX18) - BSA

NB120-6405

Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free

(36 Publications)

Species: Rt

Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

MMP-3 [HRP]

DMP300

(53 Publications)

Species: Hu

Applications: ELISA

Publications for Smoothelin Recombinant Protein (H00006525-P01) (0)

There are no publications for Smoothelin Recombinant Protein (H00006525-P01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smoothelin Recombinant Protein (H00006525-P01) (0)

There are no reviews for Smoothelin Recombinant Protein (H00006525-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smoothelin Recombinant Protein (H00006525-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smoothelin Products

Blogs on Smoothelin

There are no specific blogs for Smoothelin, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.

Myosin Heavy Chain Antibody (MF20) [Unconjugated]
MAB4470

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human Smoothelin GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

SMTN

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human Smoothelin GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human Smoothelin GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human Smoothelin GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Smoothelin Recombinant Protein (H00006525-P01) (0)

Reviews for Smoothelin Recombinant Protein (H00006525-P01) (0)

Product General Protocols

Video Protocols

FAQs for Smoothelin Recombinant Protein (H00006525-P01) (0)

Additional Smoothelin Products

Blogs on Smoothelin

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics