Home » SMCP » SMCP Proteins » SMCP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SMCP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SMCP Protein (NBP1-81252PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SMCP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMCP.

Source: E. coli

Amino Acid Sequence: KHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMCP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81252.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMCP Recombinant Protein Antigen

  • HSMCSGEN1
  • MCSMGC26305
  • MCSPMGC26519
  • mitochondrial capsule selenoprotein
  • sperm mitochondria-associated cysteine-rich protein
  • sperm mitochondrial-associated cysteine-rich protein

Background

Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated,flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. Theprotein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thoughtto function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NG2/MCSP Antibody
(LHM 2)
NB100-2688
Flow Cytometry NG2/MCSP Antibody (LHM 2)
Knockout Validated NG2/MCSP Antibody (LHM 2)
Flow Cytometry NG2/MCSP Antibody (LHM 2)
(13 Publications)
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MOCOS Antibody
NBP2-14243
Western Blot MOCOS Antibody
Simple Western MOCOS Antibody
Simple Western MOCOS Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MOS Antibody
NBP1-86241
Western Blot MOS Antibody
Immunohistochemistry-Paraffin MOS Antibody
Species: Hu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Contactin-3
Antibody [Unconjugate
AF5539
Western Blot Contactin-3 Antibody [Unconjugated]
Immunocytochemistry Contactin-3 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
Acrosin Antibody
NBP2-14260
Immunohistochemistry-Paraffin Acrosin Antibody
Immunohistochemistry-Paraffin Acrosin Antibody
Immunohistochemistry-Paraffin Acrosin Antibody
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Huntingtin Antibody
NBP3-13106
Western Blot Huntingtin Antibody
Immunohistochemistry-Paraffin Huntingtin Antibody
Immunocytochemistry/ Immunofluorescence Huntingtin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
(1 Publication)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
UBN1 Antibody
NBP3-17956
Immunocytochemistry/ Immunofluorescence UBN1 Antibody
Western Blot UBN1 Antibody
Species: Hu
Applications: ICC/IF, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(665 Publications)
Species: Mu
Applications: ELISA
Musculin Antibody
(1D1)
H00009242-M01
Western Blot Musculin Antibody (1D1)
(1 Review)
Species: Hu
Applications: ELISA, WB

Publications for SMCP Protein (NBP1-81252PEP) (0)

There are no publications for SMCP Protein (NBP1-81252PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMCP Protein (NBP1-81252PEP) (0)

There are no reviews for SMCP Protein (NBP1-81252PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMCP Protein (NBP1-81252PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMCP Products

Blogs on SMCP

There are no specific blogs for SMCP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMCP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SMCP