SLC9A7 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC9A7. Source: E. coli
Amino Acid Sequence: QVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
SLC9A7 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13347. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SLC9A7 Recombinant Protein Antigen
Background
Na+/H+ exchangers (NHE) of mammalian cells are plasma membrane intrinsic proteins mediating exchange of N+ and H+ ions in various tissues. The NHE catalyzes the electroneural transport of extracellular Na+ for intracellular H+. They play a major role in regulation of intracellular pH (pHi) in addition to trans-cellular absorption of Na+, cell volume regulation and possibly in cell proliferation. These primary functions of the Na+/H+ exchanger have been related to many pathophysiological states, include hypertension, organ growth and hypertrophy, regression of cancer and renal intestinal disorders. At least 7 NHE isoforms (NHE1-7) have been cloned so far. They are all similar in their primary structure and predicted to have 10-12 transmembrane domains. The C-terminal domain of NHEs are predicted to be intracellular. NHE7 (human 725 aa, chromosome Xp11.4) is ubiquitously expressed, and predominantly localizes to the trans-golgi network. NHE7 mediates the influx of Na+ or K+ in exchange for H+. It is ~70% related to NHE6 but relatively less (~25%) homologous with other NHEs.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Publications for SLC9A7 Protein (NBP2-13347PEP) (0)
There are no publications for SLC9A7 Protein (NBP2-13347PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC9A7 Protein (NBP2-13347PEP) (0)
There are no reviews for SLC9A7 Protein (NBP2-13347PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SLC9A7 Protein (NBP2-13347PEP) (0)
Additional SLC9A7 Products
Blogs on SLC9A7