![Immunocytochemistry/Immunofluorescence: SLC7A6 Antibody [NBP2-30868] - Immunofluorescent staining of human cell line HeLa shows localization to vesicles.](http://images.novusbio.com/fullsize/SLC7A6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30868-img0002.jpg "Immunocytochemistry/Immunofluorescence: SLC7A6 Antibody [NBP2-30868] - Immunofluorescent staining of human cell line HeLa shows localization to vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC7A6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Western_Blot_5396.jpg)
![Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]](https://images.novusbio.com/images2/NTAL_AF4066_Flow_Cytometry_8223.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC7A6 Antibody (NBP2-30868)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SLC7A6 Antibody [NBP2-30868] - Staining of human breast shows distinct positivity in myoepithelial cells.](http://images.novusbio.com/fullsize/SLC7A6-Antibody-Immunohistochemistry-Paraffin-NBP2-30868-img0003.jpg "Immunohistochemistry-Paraffin: SLC7A6 Antibody [NBP2-30868] - Staining of human breast shows distinct positivity in myoepithelial cells.")
![Angiopoietin-1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Angiopoietin-1 [Unconjugated]")
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Western_Blot_6125.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1Acid_Glycoprotein_MAB3694_Western_Blot_21887.jpg)
![Immunohistochemistry alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Immunohistochemistry_9988.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")