![Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Western blot analysis of extracts of various cell lines, using SLC6A4/5-HTTLPR/Serotonin transporter antibody (NBP3-15668) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/SLC6A4-5-HTTLPR-Serotonin-transporter-Antibody-5T7M2-Western-Blot-NBP3-15668-img0002.jpg "Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Western blot analysis of extracts of various cell lines, using SLC6A4/5-HTTLPR/Serotonin transporter antibody (NBP3-15668) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 5T7M2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC6A4/5-HTTLPR/Serotonin transporter (NP_001036.1). METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SLC6A4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (NBP3-15668)Find related products by research area.
|
|
Epigenetics of Depression: How Can Psychological Stress Alter Your DNA? By Emily Cartwright, PhDHow Can Psychological Stress Alter Your DNA? Traumatic events, work demands, relationship conflicts, and health problems are all examples of psychological stressors that can result in phy... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC6A4 |
![Immunocytochemistry/Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Immunofluorescence analysis of human liver cancer using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb (NBP3-15668) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/SLC6A4-5-HTTLPR-Serotonin-transporter-Antibody-5T7M2-Immunocytochemistry-Immunofluorescence-NBP3-15668-img0001.jpg "Immunocytochemistry/Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Immunofluorescence analysis of human liver cancer using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb (NBP3-15668) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Western blot analysis of extracts of various cell lines, using SLC6A4/5-HTTLPR/Serotonin transporter antibody (NBP3-15668) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/SLC6A4-5-HTTLPR-Serotonin-transporter-Antibody-5T7M2-Western-Blot-NBP3-15668-img0003.jpg "Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Western blot analysis of extracts of various cell lines, using SLC6A4/5-HTTLPR/Serotonin transporter antibody (NBP3-15668) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
![Immunocytochemistry/ Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Confocal imaging of paraffin-embedded Human liver cancer tissue using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15668_rabbit-slc6a4-5-httlpr-serotonin-transporter-mab-5t7m2-52202517304953.jpg "Immunocytochemistry/ Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Confocal imaging of paraffin-embedded Human liver cancer tissue using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Western blot analysis of rat brain using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.](http://images.novusbio.com/fullsize/nbp3-15668_rabbit-slc6a4-5-httlpr-serotonin-transporter-mab-5t7m2-52202517311027.jpg "Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Western blot analysis of rat brain using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.")
![Immunoprecipitation: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Immunoprecipitation of SLC6A4/5-HTTLPR/Serotonin transporter from 500 ug extracts of HT-29 cells was performed using 2 ug of SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb . Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at a dilution of 1:1000.](http://images.novusbio.com/fullsize/nbp3-15668_rabbit-slc6a4-5-httlpr-serotonin-transporter-mab-5t7m2-5220251734576.jpg "Immunoprecipitation: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Immunoprecipitation of SLC6A4/5-HTTLPR/Serotonin transporter from 500 ug extracts of HT-29 cells was performed using 2 ug of SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb . Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at a dilution of 1:1000.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")