![Western Blot: SLC34A1 Antibody [NBP2-85748] - Host: Rabbit. Target Name: Slc34a1. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/SLC34A1-Antibody-Western-Blot-NBP2-85748-img0001.jpg "Western Blot: SLC34A1 Antibody [NBP2-85748] - Host: Rabbit. Target Name: Slc34a1. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of rat SLC34A1. Peptide sequence: YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC34A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC34A1 Antibody (NBP2-85748)Find related products by research area.
|
|
SLC34A1 - major regulator of inorganic phosphate (Pi) homeostasis SLC34A1 encodes the 69 kDa sodium-dependent phosphate transport protein 2A (Npt2a). SLC34A is a member of the type II sodium-phosphate co-transporter family, along with SLC34A3 which encodes Npt2c. These proteins are abundantly expressed along the... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC34A1 |
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images2/FGF23_MAB26291_Immunohistochemistry_17626.jpg)
![Immunohistochemistry FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412512640.jpg)
![Western Blot FGF-23 Antibody (283507) [Unconjugated]](https://images.novusbio.com/images/mab26291_mouse-fgf-23-mab-clone-283507-41202412514876.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Immunohistochemistry Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_Immunohistochemistry_6720.jpg)
![Western Blot Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_Western_Blot_22658.jpg)
![ELISA Klotho Antibody [Unconjugated]](https://images.novusbio.com/images2/Klotho_AF1819_ELISA_22841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
