![Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - SLC25A13 monoclonal antibody (M01), clone 4F4 Analysis of SLC25A13 expression in HepG2.](http://images.novusbio.com/fullsize/SLC25A13-Antibody-4F4-Western-Blot-H00010165-M01-img0010.jpg "Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - SLC25A13 monoclonal antibody (M01), clone 4F4 Analysis of SLC25A13 expression in HepG2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, KD |
| Clone | 4F4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SLC25A13 (NP_055066, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVA |
| Specificity | solute carrier family 25, member 13 (citrin) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC25A13 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using H00010165-M01 | Applications | Species |
|---|---|---|
| Rabinovich S, Adler L, Yizhak K et al. Diversion of aspartate in ASS1-deficient tumours fosters de novo pyrimidine synthesis. Nature 2015-11-19 [PMID: 26560030] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of monoclonal antibody to SLC25A13 on HepG2 cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/SLC25A13-Antibody-4F4-Immunocytochemistry-Immunofluorescence-H00010165-M01-img0007.jpg "Immunocytochemistry/Immunofluorescence: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of monoclonal antibody to SLC25A13 on HepG2 cell. Antibody concentration 10 ug/ml.")
![Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of SLC25A13 over-expressed 293 cell line, cotransfected with SLC25A13 Validated Chimera RNAi ( Cat # H00010165-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC25A13 monoclonal antibody (M01), clone 4F4 (Cat # H00010165-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/SLC25A13-Antibody-4F4-Western-Blot-H00010165-M01-img0008.jpg "Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of SLC25A13 over-expressed 293 cell line, cotransfected with SLC25A13 Validated Chimera RNAi ( Cat # H00010165-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC25A13 monoclonal antibody (M01), clone 4F4 (Cat # H00010165-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibody (M01), clone 4F4.Lane 1: SLC25A13 transfected lysate(74.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SLC25A13-Antibody-4F4-Western-Blot-H00010165-M01-img0011.jpg "Western Blot: SLC25A13 Antibody (4F4) [H00010165-M01] - Analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibody (M01), clone 4F4.Lane 1: SLC25A13 transfected lysate(74.2 KDa).Lane 2: Non-transfected lysate.")
![ELISA: SLC25A13 Antibody (4F4) [H00010165-M01] - Detection limit for recombinant GST tagged SLC25A13 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SLC25A13-Antibody-4F4-ELISA-H00010165-M01-img0012.jpg "ELISA: SLC25A13 Antibody (4F4) [H00010165-M01] - Detection limit for recombinant GST tagged SLC25A13 is approximately 0.3ng/ml as a capture antibody.")
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
