![Western Blot: SLC15A3 Antibody (5B4) [H00051296-M04-100ug] - Monoclonal antibody (M04), clone 5B4. Western Blot analysis of SLC15A3 expression in PC-12.](http://images.novusbio.com/fullsize/SLC15A3-Antibody-5B4-Western-Blot-H00051296-M04-100ug-img0001.jpg "Western Blot: SLC15A3 Antibody (5B4) [H00051296-M04-100ug] - Monoclonal antibody (M04), clone 5B4. Western Blot analysis of SLC15A3 expression in PC-12.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 5B4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SLC15A3 (NP_057666.1, 254 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC15A3 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC15A3 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![ELISA: SLC15A3 Antibody (5B4) [H00051296-M04-100ug] - Detection limit for recombinant GST tagged SLC15A3 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SLC15A3-Antibody-5B4-ELISA-H00051296-M04-100ug-img0002.jpg "ELISA: SLC15A3 Antibody (5B4) [H00051296-M04-100ug] - Detection limit for recombinant GST tagged SLC15A3 is 0.3 ng/ml as a capture antibody.")
![Western Blot Cadherin-17 Antibody (141713) [Unconjugated]](https://images.novusbio.com/images2/Cadherin17_MAB1032_Western_Blot_16734.jpg)
![Immunohistochemistry Cadherin-17 Antibody (141713) [Unconjugated]](https://images.novusbio.com/images2/Cadherin17_MAB1032_Immunohistochemistry_23006.jpg)
![Immunohistochemistry Cadherin-17 Antibody (141713) [Unconjugated]](https://images.novusbio.com/images2/Cadherin17_MAB1032_Immunohistochemistry_23007.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Western_Blot_6125.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1Acid_Glycoprotein_MAB3694_Western_Blot_21887.jpg)
![Immunohistochemistry alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Immunohistochemistry_9988.jpg)
