![Immunocytochemistry/Immunofluorescence: SLC15A4 Antibody [NBP1-87279] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC15A4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87279-img0019.jpg "Immunocytochemistry/Immunofluorescence: SLC15A4 Antibody [NBP1-87279] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC15A4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF: Fixation/Permeabilization: PFA/Triton X-100. Simple Western internal validation: RT-4 and U-251MG as samples; separated by size; antibody dilution of 1:4; observed molecular weight was ~63 kDa; matrix was 12-230 kDa; detected by Chemiluminescence. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87279 | Applications | Species |
|---|---|---|
| Boakye AA, Zhang D, Guo L et al. Carnosine Supplementation Enhances Post Ischemic Hind Limb Revascularization Front Physiol 2019-07-02 [PMID: 31312142] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC15A4 |
![Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human colon shows moderate to strong positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC15A4-Antibody-Immunohistochemistry-Paraffin-NBP1-87279-img0018.jpg "Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human colon shows moderate to strong positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/SLC15A4-Antibody-Immunohistochemistry-Paraffin-NBP1-87279-img0015.jpg "Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human lymph node shows moderate to strong positivity in lymphoid cells.](http://images.novusbio.com/fullsize/SLC15A4-Antibody-Immunohistochemistry-Paraffin-NBP1-87279-img0016.jpg "Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human lymph node shows moderate to strong positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human testis shows moderate to strong positivity.](http://images.novusbio.com/fullsize/SLC15A4-Antibody-Immunohistochemistry-Paraffin-NBP1-87279-img0017.jpg "Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human testis shows moderate to strong positivity.")
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot Cadherin-17 Antibody (141713) [Unconjugated]](https://images.novusbio.com/images2/Cadherin17_MAB1032_Western_Blot_16734.jpg)
![Immunohistochemistry Cadherin-17 Antibody (141713) [Unconjugated]](https://images.novusbio.com/images2/Cadherin17_MAB1032_Immunohistochemistry_23006.jpg)
![Immunohistochemistry Cadherin-17 Antibody (141713) [Unconjugated]](https://images.novusbio.com/images2/Cadherin17_MAB1032_Immunohistochemistry_23007.jpg)
![Western Blot Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Western_Blot_5594.jpg)
![Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Chromatin_Immunoprecipitation_11241.jpg)
![Simple Western Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Simple_Western_16946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")