![Knockdown Validated: Serpin B5/Maspin Antibody [NBP1-87778] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and MASPIN/Serpin B5 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.5 ug/ml of Rabbit Anti-Human MASPIN/Serpin B5 Polyclonal Antibody (Catalog # NBP1-87778) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for MASPIN/Serpin B5 at approximately 40 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Knockdown-Validated-NBP1-87778-img0020.jpg "Knockdown Validated: Serpin B5/Maspin Antibody [NBP1-87778] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and MASPIN/Serpin B5 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.5 ug/ml of Rabbit Anti-Human MASPIN/Serpin B5 Polyclonal Antibody (Catalog # NBP1-87778) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for MASPIN/Serpin B5 at approximately 40 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRVNKT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SERPINB5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Knockout Validated SerpinB2 Antibody (930109) [Unconjugated]](https://images.novusbio.com/images2/Serpin_B2_MAB8550_Knockout_Validated_21056.jpg)
![Immunocytochemistry SerpinB2 Antibody (930109) [Unconjugated]](https://images.novusbio.com/images2/Serpin_B2_MAB8550_Immunocytochemistry__Immunofluorescence_17162.jpg)
![Western Blot SerpinB2 Antibody (930109) [Unconjugated]](https://images.novusbio.com/images2/Serpin_B2_MAB8550_Western_Blot_17242.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Serpin B5/Maspin Antibody (NBP1-87778)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SERPINB5 |
![Western Blot: Serpin B5/Maspin Antibody [NBP1-87778] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Western-Blot-NBP1-87778-img0019.jpg "Western Blot: Serpin B5/Maspin Antibody [NBP1-87778] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human liver.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Immunohistochemistry-Paraffin-NBP1-87778-img0017.jpg "Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human liver.")
![Western Blot: Serpin B5/Maspin Antibody [NBP1-87778] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Western-Blot-NBP1-87778-img0011.jpg "Western Blot: Serpin B5/Maspin Antibody [NBP1-87778] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Western Blot: Serpin B5/Maspin Antibody [NBP1-87778] - Analysis in human cell lines PC-3 and Caco-2 using Anti-SERPINB5 antibody. Corresponding SERPINB5 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Western-Blot-NBP1-87778-img0018.jpg "Western Blot: Serpin B5/Maspin Antibody [NBP1-87778] - Analysis in human cell lines PC-3 and Caco-2 using Anti-SERPINB5 antibody. Corresponding SERPINB5 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
![Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human cerebral cortex, liver, skin and testis using Anti-SERPINB5 antibody NBP1-87778 (A) shows similar protein distribution across tissues to independent antibody NBP1-87780 (B).](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Immunohistochemistry-Paraffin-NBP1-87778-img0012.jpg "Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human cerebral cortex, liver, skin and testis using Anti-SERPINB5 antibody NBP1-87778 (A) shows similar protein distribution across tissues to independent antibody NBP1-87780 (B).")
![Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human skin.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Immunohistochemistry-Paraffin-NBP1-87778-img0014.jpg "Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human skin.")
![Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Immunohistochemistry-Paraffin-NBP1-87778-img0015.jpg "Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human testis.](http://images.novusbio.com/fullsize/Serpin-B5-Maspin-Antibody-Immunohistochemistry-Paraffin-NBP1-87778-img0016.jpg "Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87778] - Staining of human testis.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry__Immunofluorescence_17000.jpg)
![Western Blot CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Western_Blot_11997.jpg)
![Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]](https://images.novusbio.com/images2/CKAP4_AF7355_Immunocytochemistry_12002.jpg)
![N/A uPAR [HRP]](https://images.novusbio.com/images2/DATA_uPAR_DUP00_ELISA_866.jpg)
![N/A uPAR [HRP]](https://images.novusbio.com/images2/uPAR_DUP00_ELISA_203.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![N/A Thrombospondin-1 [HRP]](https://images.novusbio.com/images2/Thrombospondin-1_DTSP10_ELISA_199.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")