![Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Analysis in human lymph node and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Immunohistochemistry-Paraffin-NBP2-13294-img0014.jpg "Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Analysis in human lymph node and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: LGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SEPTIN9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Septin-9 Antibody (NBP2-13294)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SEPTIN9 |
![Western Blot: Septin-9 Antibody [NBP2-13294] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using anti-SEPT9 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Western-Blot-NBP2-13294-img0008.jpg "Western Blot: Septin-9 Antibody [NBP2-13294] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1, using anti-SEPT9 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: Septin-9 Antibody [NBP2-13294] - Staining of human cell line A-431 shows localization to actin filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13294-img0006.jpg "Immunocytochemistry/Immunofluorescence: Septin-9 Antibody [NBP2-13294] - Staining of human cell line A-431 shows localization to actin filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Immunohistochemistry-Paraffin-NBP2-13294-img0015.jpg "Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human skeletal muscle shows no positivity in myocytes.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Immunohistochemistry-Paraffin-NBP2-13294-img0009.jpg "Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human skeletal muscle shows no positivity in myocytes.")
![Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Immunohistochemistry-Paraffin-NBP2-13294-img0010.jpg "Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Immunohistochemistry-Paraffin-NBP2-13294-img0011.jpg "Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells.")
![Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Septin-9-Antibody-Immunohistochemistry-Paraffin-NBP2-13294-img0013.jpg "Immunohistochemistry-Paraffin: Septin-9 Antibody [NBP2-13294] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot MIF Antibody (12302) [Unconjugated]](https://images.novusbio.com/images2/MIF_MAB289_Western_Blot_16701.jpg)
![Simple Western MIF Antibody (12302) [Unconjugated]](https://images.novusbio.com/images2/MIF_MAB289_Simple_Western_18975.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")