Home » SAMD4A » SAMD4A Proteins » SAMD4A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SAMD4A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SAMD4A Protein (NBP2-13279PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SAMD4A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAMD4A.

Source: E. coli

Amino Acid Sequence: MWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSRDSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SAMD4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13279.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAMD4A Recombinant Protein Antigen

  • DKFZp434H0350
  • DKFZp686A1532
  • hSmaug1DKFZP434H0350
  • KIAA1053SMAUG1
  • protein Smaug homolog 1
  • SAM domain-containing protein 4A
  • SAMD4
  • Smaug 1
  • smaug homolog
  • Smaug
  • Smaug1
  • SMG
  • SMGA
  • sterile alpha motif domain containing 4
  • sterile alpha motif domain containing 4A
  • Sterile alpha motif domain-containing protein 4A

Background

Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as aposttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which wasnamed after the Drosophila Smaug protein (Baez and Boccaccio, 2005 (PubMed 16221671)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(793 Publications)
Species: Hu
Applications: BA
Aquaporin-5
Antibody
NBP2-39043
Immunohistochemistry-Paraffin Aquaporin-5 Antibody
Immunohistochemistry-Paraffin Aquaporin-5 Antibody
Immunohistochemistry-Paraffin Aquaporin-5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Renin Antibody
(411507) - Propeptide
MAB4447
Immunohistochemistry Renin Antibody (411507) - Propeptide
(6 Publications)
Species: Hu
Applications: IHC, WB
Rap1A/B Antibody
[Unconjugated]
AF3767
Western Blot Rap1A/B Antibody [Unconjugated]
Western Blot Rap1A/B Antibody [Unconjugated]
Immunohistochemistry Rap1A/B Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(640 Publications)
Species: Mu
Applications: ELISA
beta-NGF
[Unconjugated]
256-GF
SDS-PAGE beta-NGF [Unconjugated]
Bioactivity beta-NGF [Unconjugated]
(57 Publications)
Species: Hu
Applications: BA
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(75 Publications)
Species: Hu
Applications: IHC, IP, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(229 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
SAMD4A Recombinant
Protein Antigen
NBP2-13279PEP
SAMD4A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SAMD4A Protein (NBP2-13279PEP) (0)

There are no publications for SAMD4A Protein (NBP2-13279PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD4A Protein (NBP2-13279PEP) (0)

There are no reviews for SAMD4A Protein (NBP2-13279PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAMD4A Protein (NBP2-13279PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAMD4A Products

Array NBP2-13279PEP

Blogs on SAMD4A

There are no specific blogs for SAMD4A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAMD4A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SAMD4A