Home » Ropporin 1-like » Ropporin 1-like Proteins » Ropporin 1-like Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Ropporin 1-like Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Ropporin 1-like Protein (NBP2-47299PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Ropporin 1-like Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROPN1L.

Source: E. coli

Amino Acid Sequence: PDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ROPN1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47299.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ropporin 1-like Recombinant Protein Antigen

  • AKAP-associated sperm protein
  • ASPFLJ23003
  • FLJ25776
  • radial spoke head 11 homolog
  • rhophilin associated tail protein 1-like
  • ROPN1-like protein
  • ropporin 1-like
  • ropporin-1-like protein
  • RSPH11

Background

Ropporin 1-like is encoded by this gene is a sperm protein, which interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Complement Factor
D/Adipsin Antibody [U ...
AF5430
Western Blot Complement Factor D/Adipsin Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: IP, WB
ASRGL1 Antibody
NBP1-89133
Immunocytochemistry/ Immunofluorescence ASRGL1 Antibody
Immunohistochemistry-Paraffin ASRGL1 Antibody
Immunohistochemistry-Paraffin ASRGL1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(186 Publications)
Species: Hu
Applications: ELISA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(664 Publications)
Species: Mu
Applications: ELISA
PSP94/MSMB
Antibody (OTI6C7)
NBP2-02450
Western Blot PSP94/MSMB Antibody (OTI6C7)
Immunocytochemistry/ Immunofluorescence PSP94/MSMB Antibody (OTI6C7)
Immunohistochemistry-Paraffin PSP94/MSMB Antibody (OTI6C7)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HRSP12 Antibody
NBP1-82452
Western Blot HRSP12 Antibody
Western Blot HRSP12 Antibody
Immunohistochemistry-Paraffin HRSP12 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PSP/BPIFA2
Antibody (1F12) - BSA
NBP2-37493
ELISA PSP/BPIFA2 Antibody (1F12) - BSA Free
Western Blot PSP/BPIFA2 Antibody (1F12) - BSA Free
Immunocytochemistry/ Immunofluorescence PSP/BPIFA2 Antibody (1F12) - BSA Free
(1 Publication)
Species: Hu, Mu, Po
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
Persephin Protein
NBP2-35208
SDS-PAGE Recombinant Human Persephin Protein
Species: Hu
Applications: BA, PAGE
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB

Publications for Ropporin 1-like Protein (NBP2-47299PEP) (0)

There are no publications for Ropporin 1-like Protein (NBP2-47299PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ropporin 1-like Protein (NBP2-47299PEP) (0)

There are no reviews for Ropporin 1-like Protein (NBP2-47299PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ropporin 1-like Protein (NBP2-47299PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ropporin 1-like Products

Blogs on Ropporin 1-like

There are no specific blogs for Ropporin 1-like, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ropporin 1-like Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ROPN1L