Novus Biologicals products are now on bio-techne.com

RelB Recombinant Protein Antigen

Name: RelB Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-34064PEP
Price: 279 USD

Images

There are currently no images for RelB Protein (NBP2-34064PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RelB Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RELB. Source: E. coli Amino Acid Sequence: WKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	RELB
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34064. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RelB Recombinant Protein Antigen

IREL
I-Rel
nuclear factor of kappalight polypeptide gene enhancer in B-cells 3
RelB
v-rel reticuloendotheliosis viral oncogene homolog B

Background

RelB, also known as I-Rel, is a member of the Rel transcription factor family which also include; RelA-p65, c-Rel, NF-kB1 p100/52 and NF-kB2 p105/50 (1). Unlike other Rel-related protein, RelB does not bind to DNA or to inhibitor IkB, but is instead sequestered in the cytoplasm by precursor p100. Once p100 is processed, the p52/RelB complex translocates into the nucleus (2). RelB is also the transcription factor that has been associated most directly with dendritic cells (DCs) differentiation and function (3). It is upregulated and translocated into the nuclei of DC in response to various stimuli. RelB is also essential for generating a specific DC subset (CD11c+/CD11b+/CD8-/Dec205-) from hematopoietic stem cells (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, WB

Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...

NBP2-29661

(95 Publications)

Species: Hu, Mu, Rt

Applications: ELISA

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(817 Publications)

Species: Hu

Applications: BA

c-Rel Antibody
[Unconjugated]

AF2699

Western Blot c-Rel Antibody [Unconjugated]

(1 Review)

(3 Publications)

Species: Mu

Applications: Simple Western, WB

CD40/TNFRSF5
Antibody [Unconjugate

AF632

Western Blot CD40/TNFRSF5 Antibody [Unconjugated]

Simple Western CD40/TNFRSF5 Antibody [Unconjugated]

(7 Publications)

Species: Hu

Applications: AgAct, Simple Western, WB

NFkB2/NFkB p100
Antibody

NBP1-87760

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB

ARHGEF7 Antibody

NBP1-88650

Immunohistochemistry-Paraffin ARHGEF7 Antibody

Species: Hu

Applications: IHC, IHC-P, KD, WB

ASCC1 Antibody
(OTI6G5)

NBP2-01345

(1 Review)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Synaptotagmin 1
Antibody (ASV48) [Unc ...

MAB4364

Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]

(2 Publications)

Species: Rt

Applications: ICC, IHC, IP, KO, WB

WNK1 Antibody
[Unconjugated]

AF2849

(5 Publications)

Species: Mu, Rt

Applications: WB

GRASP65 Antibody
(OTI5G8)

NBP2-02665

Flow Cytometry GRASP65 Antibody (OTI5G8)

(3 Reviews)

(2 Publications)

Species: Ca, Hu, Pm, Po, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

LEDGF Antibody
(762815) [Unconjugate

MAB3468

Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]

(1 Review)

(1 Publication)

Species: Hu

Applications: ICC, WB

FKBP52/FKBP4
Antibody (5C11)

H00002288-M01

Western Blot FKBP52/FKBP4 Antibody (5C11)

Immunohistochemistry-Paraffin FKBP52/FKBP4 Antibody (5C11)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, IP, WB

GTF2H4 Antibody

H00002968-B01P

Immunocytochemistry/ Immunofluorescence GTF2H4 Antibody

Species: Hu

Applications: ICC/IF, WB

Doublecortin
Antibody

NBP1-72042

Immunocytochemistry/ Immunofluorescence Doublecortin Antibody

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

IkB-alpha Antibody
(6A920) - BSA Free

NB100-56507

Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free

(42 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB

SND1 Antibody -
Azide and BSA Free

NBP2-94469

Knockout Validated SND1 Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin SND1 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, KO, WB

PMEL17/SILV
Antibody (HMB45)

NBP2-44520

Immunohistochemistry PMEL17/SILV Antibody (HMB45)

(8 Publications)

Species: Ca(-), Hu, Rt(-)

Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB

OAS3 Antibody

NBP1-85841

Immunohistochemistry-Paraffin OAS3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

SART3 Antibody

NB100-74648

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for RelB Protein (NBP2-34064PEP) (0)

There are no publications for RelB Protein (NBP2-34064PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RelB Protein (NBP2-34064PEP) (0)

There are no reviews for RelB Protein (NBP2-34064PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RelB Protein (NBP2-34064PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RelB Products

Research Areas for RelB Protein (NBP2-34064PEP)

Find related products by research area.

Phospho-Specific

Blogs on RelB.

Check out the latest blog posts on RelB.

NFkB and p62 Both Activate and Regulate Inflammation
Nuclear factor kappa-light-chain-enhancer of activated B cells (NFkB) is a protein complex that regulates DNA transcription and is a critical regulator of cell survival. NFkB has long been known as a primer of inflammation, however researchers are ... Read full blog post.

RelA/NF-kB - A proinflammatory signaling pathway with roles in immunity and cancer
The inflammatory response consists of a complex network of signaling pathways that regulate a diverse set of cytokines, growth factors, adhesion molecules, and transcription factors (1). Of the proinflammatory signaling pathways the NF-kB family is... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our RelB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

RELB

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

RelB Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

RelB Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for RelB Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for RelB Protein (NBP2-34064PEP) (0)

Reviews for RelB Protein (NBP2-34064PEP) (0)

FAQs for RelB Protein (NBP2-34064PEP) (0)

Additional RelB Products

Research Areas for RelB Protein (NBP2-34064PEP)

Blogs on RelB.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics