![Western Blot: RCC1 Antibody [NBP3-38248] - Western blot analysis of various lysates using RCC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.](http://images.novusbio.com/fullsize/nbp3-38248_rabbit-rcc1-pab-101220241243932.jpg "Western Blot: RCC1 Antibody [NBP3-38248] - Western blot analysis of various lysates using RCC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RCC1 (NP_001260.1). Sequence: MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RCC1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RCC1 Antibody (NBP3-38248)Find related products by research area.
|
|
Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD) Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm. Transportin 1 is co... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RCC1 |
![Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38248_rabbit-rcc1-pab-101220241252839.jpg "Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: RCC1 Antibody [NBP3-38248] - Immunofluorescence analysis of HeLa cells using RCC1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-38248_rabbit-rcc1-pab-101220241233859.jpg "Immunocytochemistry/ Immunofluorescence: RCC1 Antibody [NBP3-38248] - Immunofluorescence analysis of HeLa cells using RCC1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Rat lung using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38248_rabbit-rcc1-pab-101220241154554.jpg "Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Rat lung using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38248_rabbit-rcc1-pab-1012202411535869.jpg "Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")