Home » RB1CC1 » RB1CC1 Proteins » RB1CC1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RB1CC1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RB1CC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RB1CC1.

Source: E. coli

Amino Acid Sequence: MKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RB1CC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48572.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RB1CC1 Recombinant Protein Antigen

  • CC1
  • DRAGOU14
  • FIP200
  • KIAA0203200 kDa FAK family kinase-interacting protein
  • RB1-inducible coiled-coil 1
  • RB1-inducible coiled-coil protein 1
  • RBICC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ULK1 Antibody -
BSA Free
NBP2-41217
Immunocytochemistry/ Immunofluorescence ULK1 Antibody - BSA Free
Western Blot ULK1 Antibody - BSA Free
Immunohistochemistry-Paraffin ULK1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
FAK Antibody
[Unconjugated]
AF4467
Immunohistochemistry FAK Antibody [Unconjugated]
Knockout Validated FAK Antibody [Unconjugated]
Western Blot FAK Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NG2/MCSP Antibody
(LHM 2)
NB100-2688
Flow Cytometry NG2/MCSP Antibody (LHM 2)
Knockout Validated NG2/MCSP Antibody (LHM 2)
Flow Cytometry NG2/MCSP Antibody (LHM 2)
(13 Publications)
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SNF5 Antibody
(3E10)
H00006598-M01
ELISA SNF5 Antibody (3E10)
Immunohistochemistry-Paraffin SNF5 Antibody (3E10)
Western Blot SNF5 Antibody (3E10)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CEACAM1/CD66a
Antibody [Unconjugate
AF6480
Western Blot CEACAM1/CD66a Antibody [Unconjugated]
Flow Cytometry CEACAM1/CD66a Antibody [Unconjugated]
Immunohistochemistry CEACAM1/CD66a Antibody [Unconjugated]
(5 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
RNF5 Antibody -
BSA Free
NBP2-94913
Immunohistochemistry-Paraffin RNF5 Antibody - BSA Free
Immunohistochemistry-Paraffin RNF5 Antibody - BSA Free
Western Blot RNF5 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
p62/SQSTM1
Antibody (2C11)
H00008878-M01
Immunocytochemistry/ Immunofluorescence p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
Western Blot p62/SQSTM1 Antibody (2C11)
(9 Reviews)
(413 Publications)
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NHE6/SLC9A6
Antibody
NBP2-38877
Immunocytochemistry/ Immunofluorescence NHE6/SLC9A6 Antibody
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ATG13 [p Ser355]
Antibody
NBP2-19127
Western Blot ATG13 [p Ser355] Antibody
(19 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, KD, WB
TSC1 Antibody
(OTI3A2)
NBP2-46234
Western Blot TSC1 Antibody (OTI3A2)
Western Blot TSC1 Antibody (OTI3A2)
Immunohistochemistry TSC1 Antibody (OTI3A2)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RB1CC1 Recombinant
Protein Antigen
NBP2-48572PEP
RB1CC1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP) (0)

There are no publications for RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP) (0)

There are no reviews for RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RB1CC1 Products

Research Areas for RB1CC1 Recombinant Protein Antigen (NBP2-48572PEP)

Find related products by research area.

Blogs on RB1CC1.

Check out the latest blog posts on RB1CC1.
Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Analysis of p62 in SH-SY5Y cells using anti-p62/SQSTM1 antibody. Red - p62 puncta; Blue - nuclear DAPI; Green - Cytoskeleton. Image from verified customer review.
p62/SQSTM1 Antibody (2C11)
H00008878-M01
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RB1CC1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RB1CC1