![Western Blot: RASSF4 Antibody [NBP1-89249] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/RASSF4-Antibody-Western-Blot-NBP1-89249-img0004.jpg "Western Blot: RASSF4 Antibody [NBP1-89249] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RASSF4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RASSF2 Antibody [Unconjugated]](https://images.novusbio.com/images2/RASSF2_AF5639_Western_Blot_5789.jpg)
![Immunocytochemistry RASSF2 Antibody [Unconjugated]](https://images.novusbio.com/images2/RASSF2_AF5639_Immunocytochemistry__Immunofluorescence_19601.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RASSF4 |
![Immunocytochemistry/Immunofluorescence: RASSF4 Antibody [NBP1-89249] - Staining of human cell line A-431 shows localization to nucleus, nucleoli & cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RASSF4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89249-img0006.jpg "Immunocytochemistry/Immunofluorescence: RASSF4 Antibody [NBP1-89249] - Staining of human cell line A-431 shows localization to nucleus, nucleoli & cell junctions. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glanuldar cells.](http://images.novusbio.com/fullsize/RASSF4-Antibody-Immunohistochemistry-Paraffin-NBP1-89249-img0010.jpg "Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glanuldar cells.")
![Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human stomach shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RASSF4-Antibody-Immunohistochemistry-Paraffin-NBP1-89249-img0007.jpg "Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human stomach shows moderate to strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human kidney shows strong nuclear postivity in glomeruli.](http://images.novusbio.com/fullsize/RASSF4-Antibody-Immunohistochemistry-Paraffin-NBP1-89249-img0008.jpg "Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human kidney shows strong nuclear postivity in glomeruli.")
![Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RASSF4-Antibody-Immunohistochemistry-Paraffin-NBP1-89249-img0009.jpg "Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")