![Western Blot: RAB27B Antibody [H00005874-B01P] - Analysis of RAB27B expression in transfected 293T cell line by RAB27B polyclonal antibody. Lane 1: RAB27B transfected lysate(24.09 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Western-Blot-H00005874-B01P-img0002.jpg "Western Blot: RAB27B Antibody [H00005874-B01P] - Analysis of RAB27B expression in transfected 293T cell line by RAB27B polyclonal antibody. Lane 1: RAB27B transfected lysate(24.09 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | Hu, RbSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | RAB27B (AAH27474, 1 a.a. - 218 a.a.) full-length human protein. MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRSWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC |
| Specificity | RAB27B - RAB27B, member RAS oncogene family, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | RAB27B |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. ICC/IF usage was reported in scientific literature. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
ICC | Other | 05/27/2009 |
Summary
|
|||||||||
|
reviewed by:
Verified Customer |
WB | Other | 05/27/2009 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB27B Antibody (H00005874-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 05/27/2009 |
||
| Application: | ICC | |
| Species: | Other |
| Verified Customer 05/27/2009 |
||
| Application: | WB | |
| Species: | Other |
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")