![Western Blot: PRPSAP2 Antibody [H00005636-B01P] - Analysis of PRPSAP2 expression in transfected 293T cell line by PRPSAP2 polyclonal antibody. Lane 1: PRPSAP2 transfected lysate(40.59 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PRPSAP2-Antibody-Western-Blot-H00005636-B01P-img0004.jpg "Western Blot: PRPSAP2 Antibody [H00005636-B01P] - Analysis of PRPSAP2 expression in transfected 293T cell line by PRPSAP2 polyclonal antibody. Lane 1: PRPSAP2 transfected lysate(40.59 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | PRPSAP2 (NP_002758.1, 1 a.a. - 369 a.a.) full-length human protein. MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD |
| Specificity | PRPSAP2 - phosphoribosyl pyrophosphate synthetase-associated protein 2, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PRPSAP2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRPSAP2 Antibody (H00005636-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRPSAP2 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: PRPSAP2 Antibody [H00005636-B01P] - Analysis of purified antibody to PRPSAP2 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/PRPSAP2-Antibody-Immunocytochemistry-Immunofluorescence-H00005636-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: PRPSAP2 Antibody [H00005636-B01P] - Analysis of purified antibody to PRPSAP2 on HeLa cell. (antibody concentration 10 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")