![Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human colon, kidney, liver and testis using Anti-PROS1 antibody NBP1-87218 (A) shows similar protein distribution across tissues to independent antibody NBP1-87217 (B).](http://images.novusbio.com/fullsize/Protein-S-PROS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87218-img0006.jpg "Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human colon, kidney, liver and testis using Anti-PROS1 antibody NBP1-87218 (A) shows similar protein distribution across tissues to independent antibody NBP1-87217 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PROS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
| Publication using NBP1-87218 | Applications | Species |
|---|---|---|
| Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PROS1 |
![Western Blot: Protein S/PROS1 Antibody [NBP1-87218] - Analysis in human plasma.](http://images.novusbio.com/fullsize/Protein-S-PROS1-Antibody-Western-Blot-NBP1-87218-img0005.jpg "Western Blot: Protein S/PROS1 Antibody [NBP1-87218] - Analysis in human plasma.")
![Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human kidney.](http://images.novusbio.com/fullsize/Protein-S-PROS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87218-img0011.jpg "Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human testis.](http://images.novusbio.com/fullsize/Protein-S-PROS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87218-img0008.jpg "Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human colon.](http://images.novusbio.com/fullsize/Protein-S-PROS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87218-img0009.jpg "Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human colon.")
![Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human liver.](http://images.novusbio.com/fullsize/Protein-S-PROS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87218-img0010.jpg "Immunohistochemistry-Paraffin: Protein S/PROS1 Antibody [NBP1-87218] - Staining of human liver.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")