![Western Blot: PPRC1 Antibody [NBP1-82985] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/PPRC1-Antibody-Western-Blot-NBP1-82985-img0006.jpg "Western Blot: PPRC1 Antibody [NBP1-82985] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASPHPKHKVSALVQSPQMKALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARLRKLSFLPTPRTQGSEDVVQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPRC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPRC1 |
![Immunocytochemistry/Immunofluorescence: PPRC1 Antibody [NBP1-82985] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PPRC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82985-img0004.jpg "Immunocytochemistry/Immunofluorescence: PPRC1 Antibody [NBP1-82985] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human liver shows no positivity in hepatoyctes as expected.](http://images.novusbio.com/fullsize/PPRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82985-img0010.jpg "Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human liver shows no positivity in hepatoyctes as expected.")
![Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/PPRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82985-img0007.jpg "Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human lymph node shows strong nuclear positivity in germinal center cells and non-germinal center cells.](http://images.novusbio.com/fullsize/PPRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82985-img0008.jpg "Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human lymph node shows strong nuclear positivity in germinal center cells and non-germinal center cells.")
![Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PPRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82985-img0009.jpg "Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")